Bos mutus (wild yak): 102282844 Help Entry 102282844         CDS       T02919                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism bom  Bos mutus (wild yak) Pathway bom04024   cAMP signaling pathway bom04080   Neuroactive ligand-receptor interaction bom04081   Hormone signaling bom04935   Growth hormone synthesis, secretion and action bom04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102282844 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102282844 (SST)    04081 Hormone signaling     102282844 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102282844 (SST)   09154 Digestive system    04971 Gastric acid secretion     102282844 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102282844 (SST) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   GPCR binding    102282844 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  102282844 NCBI-ProteinID:  XP_005899713 UniProt:  L8IBK9 LinkDB All DBs Position 1:78736596..78738051 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccggctccgtcagtttctgcagaaatccctggct gctgccgctggcaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system