Bos mutus (wild yak): 102282890 Help Entry 102282890         CDS       T02919                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism bom  Bos mutus (wild yak) Pathway bom01523   Antifolate resistance bom04010   MAPK signaling pathway bom04060   Cytokine-cytokine receptor interaction bom04064   NF-kappa B signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04625   C-type lectin receptor signaling pathway bom04640   Hematopoietic cell lineage bom04657   IL-17 signaling pathway bom04659   Th17 cell differentiation bom04668   TNF signaling pathway bom04750   Inflammatory mediator regulation of TRP channels bom04932   Non-alcoholic fatty liver disease bom04933   AGE-RAGE signaling pathway in diabetic complications bom04936   Alcoholic liver disease bom04940   Type I diabetes mellitus bom05010   Alzheimer disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05134   Legionellosis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05143   African trypanosomiasis bom05144   Malaria bom05146   Amoebiasis bom05152   Tuberculosis bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05168   Herpes simplex virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05321   Inflammatory bowel disease bom05323   Rheumatoid arthritis bom05332   Graft-versus-host disease bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102282890 (IL1B)    04064 NF-kappa B signaling pathway     102282890 (IL1B)    04668 TNF signaling pathway     102282890 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102282890 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102282890 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102282890 (IL1B)    04620 Toll-like receptor signaling pathway     102282890 (IL1B)    04621 NOD-like receptor signaling pathway     102282890 (IL1B)    04623 Cytosolic DNA-sensing pathway     102282890 (IL1B)    04625 C-type lectin receptor signaling pathway     102282890 (IL1B)    04659 Th17 cell differentiation     102282890 (IL1B)    04657 IL-17 signaling pathway     102282890 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102282890 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     102282890 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102282890 (IL1B)    05164 Influenza A     102282890 (IL1B)    05162 Measles     102282890 (IL1B)    05168 Herpes simplex virus 1 infection     102282890 (IL1B)    05163 Human cytomegalovirus infection     102282890 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     102282890 (IL1B)    05135 Yersinia infection     102282890 (IL1B)    05133 Pertussis     102282890 (IL1B)    05134 Legionellosis     102282890 (IL1B)    05152 Tuberculosis     102282890 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102282890 (IL1B)    05144 Malaria     102282890 (IL1B)    05140 Leishmaniasis     102282890 (IL1B)    05142 Chagas disease     102282890 (IL1B)    05143 African trypanosomiasis     102282890 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     102282890 (IL1B)    05321 Inflammatory bowel disease     102282890 (IL1B)    05332 Graft-versus-host disease     102282890 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102282890 (IL1B)    05020 Prion disease     102282890 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     102282890 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102282890 (IL1B)    05418 Fluid shear stress and atherosclerosis     102282890 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102282890 (IL1B)    04936 Alcoholic liver disease     102282890 (IL1B)    04932 Non-alcoholic fatty liver disease     102282890 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     102282890 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102282890 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102282890 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102282890 (IL1B) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interleukins    102282890 (IL1B) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102282890 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep TTC5_OB Motif Other DBs NCBI-GeneID:  102282890 NCBI-ProteinID:  XP_005890050 UniProt:  L8IVA9 LinkDB All DBs Position 11:60163296..60201028 Genome browser AA seq 266 aa AA seqDB search MATVPEPINEMMAYYSDENELLFEADGPKQMKSCIQHLDLGSMGDGNIQLQISHQFYNKS FRQVVSVIVAMEKLRNSAYAHVFHDDDLRSILSFIFEEEPVIFETSSDEFLCDAPVQSVK CKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNL YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQI EERPVFLGHFRGGQDITDFRMETLSP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaaccgtacctgaacccatcaacgaaatgatggcttactacagtgacgagaatgag ctgttatttgaggctgatggccccaaacagatgaagagctgcatccaacacctggacctc ggttccatgggagatggaaacatccagctgcagatttctcaccagttctacaacaaaagc ttcaggcaggtggtgtcggtcatcgtggccatggagaagctgaggaacagtgcctacgca catgtcttccatgatgatgacctgaggagcatcctttcattcatctttgaagaagagcct gtcatcttcgaaacgtcctccgacgagtttctgtgtgacgcacccgtgcagtcagtaaag tgcaaactccaggacagagagcaaaaatccctggtgctggctagcccatgtgtgctgaag gctctccacctcctctcacaggaaatgaaccgagaagtggtgttctgcatgagcttcgtg caaggagaggaaagagacaacaagattcctgtggccttgggtatcaaggacaagaatcta tacctgtcttgtgtgaaaaaaggtgatacgcccaccctgcagctggaggaagtagacccc aaagtctaccccaagaggaatatggaaaagcgttttgtcttctacaagacagaaatcaag aatacagttgaatttgagtctgtcctgtaccctaactggtacatcagcacttctcaaatc gaagaaaggcccgtcttcctgggacattttcgaggtggccaggatataactgacttcaga atggaaaccctctctccctaa

DBGET integrated database retrieval system