Bos mutus (wild yak): 102284308 Help Entry 102284308         CDS       T02919                                  Name (RefSeq) putative claudin-24   KO K06087   claudin Organism bom  Bos mutus (wild yak) Pathway bom04514   Cell adhesion molecules bom04530   Tight junction bom04670   Leukocyte transendothelial migration bom05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102284308  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102284308  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102284308  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102284308  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bom03037]     102284308    04147 Exosome [BR:bom04147]     102284308 Cilium and associated proteins [BR:bom03037]  Other cilia and associated proteins   Stereociliary proteins    102284308 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102284308   Exosomal proteins of colorectal cancer cells    102284308 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  102284308 NCBI-ProteinID:  XP_005911670 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MENWTMGLWQACVVQEEVGMQCKDFESFLGLPAELRISRVLMFVSNGLGFLGLLVSGFGL DCLRIGETQRDVKKRLLILGGILFWTAGVTALVPVSWVAHVTVQEFWDERIPEIVPRWEF GEALFIGWFAGFSLLLGGCLLNWAACGTQAPLA NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggaaaactggaccatggggctctggcaagcctgtgttgtccaggaggaagtagggatg cagtgcaaggactttgagtctttcctgggtttgcctgctgagctcaggatctccagggtt ttaatgttcgtctcgaatgggctggggttcctgggcctgctggtgtcgggctttggcctg gactgcttgaggattggagagacacagcgggacgtcaagaagcggctgttgatcctggga ggaattctgttctggacagcgggcgtcacagccctcgttcccgtctcttgggtggcccac gtgacagtgcaggagttctgggacgagcgcatccccgagattgtgcccaggtgggagttt ggagaggccctctttatcggctggtttgctggattttctctcctgctgggagggtgtctg ctgaactgggctgcctgcgggacccaggctcccctggct

DBGET integrated database retrieval system