Bos mutus (wild yak): 102284427 Help Entry 102284427         CDS       T02919                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine ligand 22   KO K21095   C-C motif chemokine 22 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102284427 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     102284427 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102284427 (CCL22)    04062 Chemokine signaling pathway     102284427 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102284427 (CCL22) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    102284427 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102284427 NCBI-ProteinID:  XP_005899944 UniProt:  L8IE17 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MASLQTPLLAAFILLAMILQATEAGPYGANVEDSVCCRDYIRYPLPLRLVKYYYWTSNSC RRPGVVLLTVKDREICADPKQHWVKKILQKLNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagacccctctcctggctgccttcatcctcctggctatgatacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcgtctgttgccgggactac atccgttaccctctgcccctgcgtttggtgaaatattactactggacttcaaattcctgc cggagacctggcgtggtcttgctgactgtgaaggaccgagagatctgtgctgaccccaaa cagcactgggtgaagaagattctccagaagctgaaccaatga

DBGET integrated database retrieval system