Bos mutus (wild yak): 102284869 Help Entry 102284869         CDS       T02919                                  Name (RefSeq) interferon omega-1-like   KO K05440   interferon omega Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04622   RIG-I-like receptor signaling pathway bom04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102284869   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102284869  09150 Organismal Systems   09151 Immune system    04622 RIG-I-like receptor signaling pathway     102284869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102284869 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interferons    102284869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DIRP Motif Other DBs NCBI-GeneID:  102284869 NCBI-ProteinID:  XP_005910616 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MAVMLSLLMALVLVSYGLGGSLGCDLSQNHMLVGRQNLRLLGQMRRLSPRFCLQDRKDFA FPQEVVEGSQLQEAQAFSVLHEMLQQTFNLFNTEHSSAAWDTTLLEPLHTGLHDRG NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggccgtcatgctctctctactgatggccctggtgcttgtcagctacggcctgggagga tccctgggctgtgacctgtctcagaaccacatgctggttggcaggcagaacctcaggctc ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagactttgct ttcccccaggaggtggtggagggtagccagctccaggaggctcaggccttctctgtgctc cacgagatgctccagcagaccttcaaccttttcaacacagagcactcctctgctgcctgg gacaccaccctcctggagccgctccacactggactccacgacagaggatga

DBGET integrated database retrieval system