KEGG   Bos mutus (wild yak): 102284931
Entry
102284931         CDS       T02919                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04140  Autophagy - animal
bom04148  Efferocytosis
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04350  TGF-beta signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04520  Adherens junction
bom04540  Gap junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04713  Circadian entrainment
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom05010  Alzheimer disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05034  Alcoholism
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05207  Chemical carcinogenesis - receptor activation
bom05208  Chemical carcinogenesis - reactive oxygen species
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102284931 (MAPK1)
   04012 ErbB signaling pathway
    102284931 (MAPK1)
   04014 Ras signaling pathway
    102284931 (MAPK1)
   04015 Rap1 signaling pathway
    102284931 (MAPK1)
   04350 TGF-beta signaling pathway
    102284931 (MAPK1)
   04370 VEGF signaling pathway
    102284931 (MAPK1)
   04371 Apelin signaling pathway
    102284931 (MAPK1)
   04668 TNF signaling pathway
    102284931 (MAPK1)
   04066 HIF-1 signaling pathway
    102284931 (MAPK1)
   04068 FoxO signaling pathway
    102284931 (MAPK1)
   04072 Phospholipase D signaling pathway
    102284931 (MAPK1)
   04071 Sphingolipid signaling pathway
    102284931 (MAPK1)
   04024 cAMP signaling pathway
    102284931 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102284931 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102284931 (MAPK1)
   04150 mTOR signaling pathway
    102284931 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102284931 (MAPK1)
   04148 Efferocytosis
    102284931 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102284931 (MAPK1)
   04210 Apoptosis
    102284931 (MAPK1)
   04218 Cellular senescence
    102284931 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102284931 (MAPK1)
   04520 Adherens junction
    102284931 (MAPK1)
   04540 Gap junction
    102284931 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102284931 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102284931 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102284931 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102284931 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102284931 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102284931 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102284931 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102284931 (MAPK1)
   04660 T cell receptor signaling pathway
    102284931 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102284931 (MAPK1)
   04659 Th17 cell differentiation
    102284931 (MAPK1)
   04657 IL-17 signaling pathway
    102284931 (MAPK1)
   04662 B cell receptor signaling pathway
    102284931 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102284931 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102284931 (MAPK1)
   04062 Chemokine signaling pathway
    102284931 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102284931 (MAPK1)
   04929 GnRH secretion
    102284931 (MAPK1)
   04912 GnRH signaling pathway
    102284931 (MAPK1)
   04915 Estrogen signaling pathway
    102284931 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102284931 (MAPK1)
   04917 Prolactin signaling pathway
    102284931 (MAPK1)
   04921 Oxytocin signaling pathway
    102284931 (MAPK1)
   04926 Relaxin signaling pathway
    102284931 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102284931 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102284931 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102284931 (MAPK1)
   04916 Melanogenesis
    102284931 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102284931 (MAPK1)
   04270 Vascular smooth muscle contraction
    102284931 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102284931 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102284931 (MAPK1)
   04725 Cholinergic synapse
    102284931 (MAPK1)
   04726 Serotonergic synapse
    102284931 (MAPK1)
   04720 Long-term potentiation
    102284931 (MAPK1)
   04730 Long-term depression
    102284931 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102284931 (MAPK1)
   04722 Neurotrophin signaling pathway
    102284931 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102284931 (MAPK1)
   04380 Osteoclast differentiation
    102284931 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102284931 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284931 (MAPK1)
   05206 MicroRNAs in cancer
    102284931 (MAPK1)
   05205 Proteoglycans in cancer
    102284931 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102284931 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102284931 (MAPK1)
   05203 Viral carcinogenesis
    102284931 (MAPK1)
   05230 Central carbon metabolism in cancer
    102284931 (MAPK1)
   05231 Choline metabolism in cancer
    102284931 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102284931 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102284931 (MAPK1)
   05212 Pancreatic cancer
    102284931 (MAPK1)
   05225 Hepatocellular carcinoma
    102284931 (MAPK1)
   05226 Gastric cancer
    102284931 (MAPK1)
   05214 Glioma
    102284931 (MAPK1)
   05216 Thyroid cancer
    102284931 (MAPK1)
   05221 Acute myeloid leukemia
    102284931 (MAPK1)
   05220 Chronic myeloid leukemia
    102284931 (MAPK1)
   05218 Melanoma
    102284931 (MAPK1)
   05211 Renal cell carcinoma
    102284931 (MAPK1)
   05219 Bladder cancer
    102284931 (MAPK1)
   05215 Prostate cancer
    102284931 (MAPK1)
   05213 Endometrial cancer
    102284931 (MAPK1)
   05224 Breast cancer
    102284931 (MAPK1)
   05223 Non-small cell lung cancer
    102284931 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102284931 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102284931 (MAPK1)
   05161 Hepatitis B
    102284931 (MAPK1)
   05160 Hepatitis C
    102284931 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102284931 (MAPK1)
   05164 Influenza A
    102284931 (MAPK1)
   05163 Human cytomegalovirus infection
    102284931 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102284931 (MAPK1)
   05165 Human papillomavirus infection
    102284931 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102284931 (MAPK1)
   05135 Yersinia infection
    102284931 (MAPK1)
   05133 Pertussis
    102284931 (MAPK1)
   05152 Tuberculosis
    102284931 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102284931 (MAPK1)
   05140 Leishmaniasis
    102284931 (MAPK1)
   05142 Chagas disease
    102284931 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102284931 (MAPK1)
   05020 Prion disease
    102284931 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102284931 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102284931 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102284931 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102284931 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102284931 (MAPK1)
   04934 Cushing syndrome
    102284931 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102284931 (MAPK1)
   01524 Platinum drug resistance
    102284931 (MAPK1)
   01522 Endocrine resistance
    102284931 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102284931 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102284931 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102284931 (MAPK1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102284931 (MAPK1)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102284931 (MAPK1)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102284931 (MAPK1)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102284931 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102284931
NCBI-ProteinID: XP_070241836
LinkDB
Position
17:complement(1088512..1145758)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagagaacgctgagagagataaagatcttactgcgcttcagacat
gagaacatcatcggaatcaatgacattattcgagcaccgaccatcgagcagatgaaagat
gtgtatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccacatctgctattttctttaccagatcctcagagggttaaagtatatt
cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac
acagggttcttgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtgggctgcatcctcgcggag
atgctctccaacaggcccatcttccccgggaagcactaccttgaccagctgaaccacatt
ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct
agaaactacctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgcggactccaaagctctggatctactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggcccatccttacctggagcagtactacgacccgagc
gatgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct
taa

DBGET integrated database retrieval system