Bos mutus (wild yak): 102286104 Help Entry 102286104         CDS       T02919                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism bom  Bos mutus (wild yak) Pathway bom04144   Endocytosis bom04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102286104 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102286104 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102286104 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102286104 (RAB10)    04031 GTP-binding proteins [BR:bom04031]     102286104 (RAB10) Membrane trafficking [BR:bom04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102286104 (RAB10)  Protein recycling   Rab GTPases and associated proteins     102286104 (RAB10) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102286104 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    102286104 (RAB10)   Exosomal proteins of colorectal cancer cells    102286104 (RAB10)   Exosomal proteins of bladder cancer cells    102286104 (RAB10) GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102286104 (RAB10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 SRPRB AAA_7 DUF3963 Motif Other DBs NCBI-GeneID:  102286104 NCBI-ProteinID:  XP_005895752 UniProt:  L8IJA2 LinkDB All DBs Position 11:33351966..33418919 Genome browser AA seq 200 aa AA seqDB search MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN SENVDISSGGGVTGWKSKCC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggactcgggagtg gggaagacctgcgtcctttttcgtttttcggatgatgccttcaacaccacctttatttcc accataggaatagactttaagatcaaaacagttgaattacaaggaaagaagatcaagcta cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctactacaga ggagcaatgggtatcatgctagtatatgacatcaccaatggtaaaagctttgaaaacatc agcaagtggcttagaaacatagatgagcatgcgaatgaagatgtggaaaggatgttacta ggaaacaagtgtgatatggacgataaaagagttgtacctaaaggaaaaggagaacagatt gcaagagagcatggtattagattttttgagactagtgcaaaagcaaatataaacatcgaa aaggcatttctcacattagctgaagatatccttcgaaagacccctgtaaaagagcccaac agtgaaaacgtagatatcagcagtggaggaggtgtgacaggctggaagagcaaatgttgc tga

DBGET integrated database retrieval system