KEGG   Bos mutus (wild yak): 102286500
Entry
102286500         CDS       T02919                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04137  Mitophagy - animal
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom05010  Alzheimer disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05034  Alcoholism
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05207  Chemical carcinogenesis - receptor activation
bom05208  Chemical carcinogenesis - reactive oxygen species
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102286500 (KRAS)
   04012 ErbB signaling pathway
    102286500 (KRAS)
   04014 Ras signaling pathway
    102286500 (KRAS)
   04015 Rap1 signaling pathway
    102286500 (KRAS)
   04370 VEGF signaling pathway
    102286500 (KRAS)
   04371 Apelin signaling pathway
    102286500 (KRAS)
   04068 FoxO signaling pathway
    102286500 (KRAS)
   04072 Phospholipase D signaling pathway
    102286500 (KRAS)
   04071 Sphingolipid signaling pathway
    102286500 (KRAS)
   04151 PI3K-Akt signaling pathway
    102286500 (KRAS)
   04150 mTOR signaling pathway
    102286500 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102286500 (KRAS)
   04137 Mitophagy - animal
    102286500 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102286500 (KRAS)
   04218 Cellular senescence
    102286500 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102286500 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102286500 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102286500 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102286500 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    102286500 (KRAS)
   04660 T cell receptor signaling pathway
    102286500 (KRAS)
   04662 B cell receptor signaling pathway
    102286500 (KRAS)
   04664 Fc epsilon RI signaling pathway
    102286500 (KRAS)
   04062 Chemokine signaling pathway
    102286500 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102286500 (KRAS)
   04929 GnRH secretion
    102286500 (KRAS)
   04912 GnRH signaling pathway
    102286500 (KRAS)
   04915 Estrogen signaling pathway
    102286500 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    102286500 (KRAS)
   04917 Prolactin signaling pathway
    102286500 (KRAS)
   04921 Oxytocin signaling pathway
    102286500 (KRAS)
   04926 Relaxin signaling pathway
    102286500 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    102286500 (KRAS)
   04919 Thyroid hormone signaling pathway
    102286500 (KRAS)
   04916 Melanogenesis
    102286500 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102286500 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102286500 (KRAS)
   04726 Serotonergic synapse
    102286500 (KRAS)
   04720 Long-term potentiation
    102286500 (KRAS)
   04730 Long-term depression
    102286500 (KRAS)
   04722 Neurotrophin signaling pathway
    102286500 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102286500 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102286500 (KRAS)
   04213 Longevity regulating pathway - multiple species
    102286500 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102286500 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286500 (KRAS)
   05206 MicroRNAs in cancer
    102286500 (KRAS)
   05205 Proteoglycans in cancer
    102286500 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    102286500 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102286500 (KRAS)
   05203 Viral carcinogenesis
    102286500 (KRAS)
   05230 Central carbon metabolism in cancer
    102286500 (KRAS)
   05231 Choline metabolism in cancer
    102286500 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102286500 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102286500 (KRAS)
   05212 Pancreatic cancer
    102286500 (KRAS)
   05225 Hepatocellular carcinoma
    102286500 (KRAS)
   05226 Gastric cancer
    102286500 (KRAS)
   05214 Glioma
    102286500 (KRAS)
   05216 Thyroid cancer
    102286500 (KRAS)
   05221 Acute myeloid leukemia
    102286500 (KRAS)
   05220 Chronic myeloid leukemia
    102286500 (KRAS)
   05218 Melanoma
    102286500 (KRAS)
   05211 Renal cell carcinoma
    102286500 (KRAS)
   05219 Bladder cancer
    102286500 (KRAS)
   05215 Prostate cancer
    102286500 (KRAS)
   05213 Endometrial cancer
    102286500 (KRAS)
   05224 Breast cancer
    102286500 (KRAS)
   05223 Non-small cell lung cancer
    102286500 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286500 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    102286500 (KRAS)
   05161 Hepatitis B
    102286500 (KRAS)
   05160 Hepatitis C
    102286500 (KRAS)
   05163 Human cytomegalovirus infection
    102286500 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286500 (KRAS)
   05165 Human papillomavirus infection
    102286500 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102286500 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102286500 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    102286500 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102286500 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102286500 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102286500 (KRAS)
   01522 Endocrine resistance
    102286500 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102286500 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bom04031]
    102286500 (KRAS)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102286500 (KRAS)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102286500 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 102286500
NCBI-ProteinID: XP_070227311
LinkDB
Position
5:complement(90013663..90056163)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system