Bos mutus (wild yak): 102286885 Help Entry 102286885         CDS       T02919                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism bom  Bos mutus (wild yak) Pathway bom03030   DNA replication bom03410   Base excision repair bom03420   Nucleotide excision repair bom03430   Mismatch repair bom03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102286885 (POLD4)    03410 Base excision repair     102286885 (POLD4)    03420 Nucleotide excision repair     102286885 (POLD4)    03430 Mismatch repair     102286885 (POLD4)    03440 Homologous recombination     102286885 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bom03032]     102286885 (POLD4)    03400 DNA repair and recombination proteins [BR:bom03400]     102286885 (POLD4) DNA replication proteins [BR:bom03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     102286885 (POLD4) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       102286885 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      102286885 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 RepB Motif Other DBs NCBI-GeneID:  102286885 NCBI-ProteinID:  XP_005903615 UniProt:  L8I584 LinkDB All DBs Position 22:66514936..66516742 Genome browser AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGSAGHSKGELAPDLGEEPLPLSVDEEELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLKPPPEVRQVLQSHPGDPRFQCSLWHFYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc gctgggcacagcaagggggagctggcaccagatctaggggaagagcccctacccctgagc gtggatgaagaggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc tgcacagggatcacacggttgcagcgctggcatcgggcagagcagatgggcttgaagcct cccccagaagtgcgtcaggtgctgcagagccaccccggggatccccgcttccagtgcagc ctctggcatttctacccgctctga

DBGET integrated database retrieval system