Bos mutus (wild yak): 102287082 Help Entry 102287082         CDS       T02919                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism bom  Bos mutus (wild yak) Pathway bom04022   cGMP-PKG signaling pathway bom04081   Hormone signaling bom04270   Vascular smooth muscle contraction bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     102287082 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     102287082 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     102287082 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102287082 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102287082 (NPPC) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   Unclassified    102287082 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  102287082 NCBI-ProteinID:  XP_070235857 LinkDB All DBs Position 2:16266937..16271567 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTPSGEEVAEPQAAGGGQKKGDKTPGGG GANLKDDRSRLLRDLRVDTKSRAAWTRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctagcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgccgccaaaggtcccgcgaactccgtccggcgaggaggtg gccgagccccaggctgcgggcggcggtcagaagaaaggcgacaagactcccgggggcggc ggcgccaatctcaaggacgaccgatcgcgactgcttcgggacctgcgcgtggacaccaag tcccgggcggcgtggacccgcctcctgcacgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system