Bos mutus (wild yak): 102287335 Help Entry 102287335         CDS       T02919                                  Symbol CCL4 Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04064   NF-kappa B signaling pathway bom04620   Toll-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102287335 (CCL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102287335 (CCL4)    04061 Viral protein interaction with cytokine and cytokine receptor     102287335 (CCL4)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102287335 (CCL4)    04623 Cytosolic DNA-sensing pathway     102287335 (CCL4)    04062 Chemokine signaling pathway     102287335 (CCL4)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102287335 (CCL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102287335 (CCL4) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    102287335 (CCL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102287335 NCBI-ProteinID:  XP_005899725 UniProt:  L8IEG3 LinkDB All DBs Position Un AA seq 92 aa AA seqDB search MKLCVTVLSLLVLMAAFCSPALSAPMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQ PAVVFQTKKGRQVCANPSEPWVQEYVDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgactgtcctgtccctcctcgtgctcatggctgccttctgttctcca gcgctctcagcaccaatgggctcagaccctcccacggcctgctgcttctcttacactctg cggaagattcctcgcaactttgtgaatgactactttgagaccagtagcctctgctcccag ccagctgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgagccc tgggtccaggagtacgtggatgaccttgaattgaactga

DBGET integrated database retrieval system