Bos mutus (wild yak): 102287375 Help Entry 102287375         CDS       T02919                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism bom  Bos mutus (wild yak) Pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04020   Calcium signaling pathway bom04022   cGMP-PKG signaling pathway bom04024   cAMP signaling pathway bom04070   Phosphatidylinositol signaling system bom04114   Oocyte meiosis bom04218   Cellular senescence bom04261   Adrenergic signaling in cardiomyocytes bom04270   Vascular smooth muscle contraction bom04371   Apelin signaling pathway bom04625   C-type lectin receptor signaling pathway bom04713   Circadian entrainment bom04720   Long-term potentiation bom04722   Neurotrophin signaling pathway bom04728   Dopaminergic synapse bom04740   Olfactory transduction bom04744   Phototransduction bom04750   Inflammatory mediator regulation of TRP channels bom04910   Insulin signaling pathway bom04912   GnRH signaling pathway bom04915   Estrogen signaling pathway bom04916   Melanogenesis bom04921   Oxytocin signaling pathway bom04922   Glucagon signaling pathway bom04924   Renin secretion bom04925   Aldosterone synthesis and secretion bom04970   Salivary secretion bom04971   Gastric acid secretion bom05010   Alzheimer disease bom05012   Parkinson disease bom05022   Pathways of neurodegeneration - multiple diseases bom05031   Amphetamine addiction bom05034   Alcoholism bom05133   Pertussis bom05152   Tuberculosis bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer bom05214   Glioma bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102287375    04015 Rap1 signaling pathway     102287375    04371 Apelin signaling pathway     102287375    04020 Calcium signaling pathway     102287375    04070 Phosphatidylinositol signaling system     102287375    04024 cAMP signaling pathway     102287375    04022 cGMP-PKG signaling pathway     102287375  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102287375    04218 Cellular senescence     102287375  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102287375   09152 Endocrine system    04910 Insulin signaling pathway     102287375    04922 Glucagon signaling pathway     102287375    04912 GnRH signaling pathway     102287375    04915 Estrogen signaling pathway     102287375    04921 Oxytocin signaling pathway     102287375    04916 Melanogenesis     102287375    04924 Renin secretion     102287375    04925 Aldosterone synthesis and secretion     102287375   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102287375    04270 Vascular smooth muscle contraction     102287375   09154 Digestive system    04970 Salivary secretion     102287375    04971 Gastric acid secretion     102287375   09156 Nervous system    04728 Dopaminergic synapse     102287375    04720 Long-term potentiation     102287375    04722 Neurotrophin signaling pathway     102287375   09157 Sensory system    04744 Phototransduction     102287375    04740 Olfactory transduction     102287375    04750 Inflammatory mediator regulation of TRP channels     102287375   09159 Environmental adaptation    04713 Circadian entrainment     102287375  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102287375   09162 Cancer: specific types    05214 Glioma     102287375   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102287375    05163 Human cytomegalovirus infection     102287375    05167 Kaposi sarcoma-associated herpesvirus infection     102287375   09171 Infectious disease: bacterial    05133 Pertussis     102287375    05152 Tuberculosis     102287375   09164 Neurodegenerative disease    05010 Alzheimer disease     102287375    05012 Parkinson disease     102287375    05022 Pathways of neurodegeneration - multiple diseases     102287375   09165 Substance dependence    05031 Amphetamine addiction     102287375    05034 Alcoholism     102287375   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102287375    05418 Fluid shear stress and atherosclerosis     102287375  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bom01009]     102287375   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102287375    03036 Chromosome and associated proteins [BR:bom03036]     102287375   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102287375 Protein phosphatases and associated proteins [BR:bom01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102287375 Membrane trafficking [BR:bom04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102287375 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102287375 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102287375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen Caleosin DUF5580_M DUF1103 TerB FCaBP_EF-hand Poly_export SPEF2_C SurA_N_3 Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  102287375 NCBI-ProteinID:  XP_070216575 LinkDB All DBs Position 22:72254554..72255655 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISATELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgaccgaagagcagattgctgaattcaaggaagctttctcccttttt gacaaagacggtgatggcaccatcacaaccaaggaacttggaaccgtcatgaggtcgttg ggccagaacccaacagaagccgaattgcaggacatgatcaacgaggtggacgctgatggt aatggcaccattgacttcccagaatttttgactatgatggctagaaaaatgaaagacacc gacagtgaagaagaaatccgcgaggcattccgagtctttgataaggatggcaacggttac atcagcgccacagagctccgccacgtcatgacaaacctgggagagaagctaacagatgag gaagtagatgagatgatcagagaagcagacatcgacggagacgggcaggtcaactacgaa gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system