Bos mutus (wild yak): 102287427 Help Entry 102287427         CDS       T02919                                  Symbol GNG12 Name (RefSeq) G protein subunit gamma 12   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism bom  Bos mutus (wild yak) Pathway bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04062   Chemokine signaling pathway bom04151   PI3K-Akt signaling pathway bom04371   Apelin signaling pathway bom04713   Circadian entrainment bom04723   Retrograde endocannabinoid signaling bom04724   Glutamatergic synapse bom04725   Cholinergic synapse bom04726   Serotonergic synapse bom04727   GABAergic synapse bom04728   Dopaminergic synapse bom04810   Regulation of actin cytoskeleton bom04926   Relaxin signaling pathway bom05032   Morphine addiction bom05034   Alcoholism bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102287427 (GNG12)    04014 Ras signaling pathway     102287427 (GNG12)    04371 Apelin signaling pathway     102287427 (GNG12)    04151 PI3K-Akt signaling pathway     102287427 (GNG12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102287427 (GNG12)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102287427 (GNG12)   09152 Endocrine system    04926 Relaxin signaling pathway     102287427 (GNG12)   09156 Nervous system    04724 Glutamatergic synapse     102287427 (GNG12)    04727 GABAergic synapse     102287427 (GNG12)    04725 Cholinergic synapse     102287427 (GNG12)    04728 Dopaminergic synapse     102287427 (GNG12)    04726 Serotonergic synapse     102287427 (GNG12)    04723 Retrograde endocannabinoid signaling     102287427 (GNG12)   09159 Environmental adaptation    04713 Circadian entrainment     102287427 (GNG12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102287427 (GNG12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102287427 (GNG12)    05163 Human cytomegalovirus infection     102287427 (GNG12)    05167 Kaposi sarcoma-associated herpesvirus infection     102287427 (GNG12)   09165 Substance dependence    05032 Morphine addiction     102287427 (GNG12)    05034 Alcoholism     102287427 (GNG12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102287427 (GNG12)    04031 GTP-binding proteins [BR:bom04031]     102287427 (GNG12) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102287427 (GNG12)   Exosomal proteins of colorectal cancer cells    102287427 (GNG12) GTP-binding proteins [BR:bom04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102287427 (GNG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CP12 Motif Other DBs NCBI-GeneID:  102287427 NCBI-ProteinID:  XP_005895838 UniProt:  L8IJ59 LinkDB All DBs Position Un AA seq 72 aa AA seqDB search MSSKTASTNNIAQARRTVQQLRMEASIERIKVSKASADLMSYCEEHARNDPLLMGIPTSE NPFKDKKTCTIL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcgagcaagacagccagtaccaacaacattgcccaggcacggaggactgtgcagcag ttgagaatggaagcctccattgagagaataaaggtttcaaaggcatcagcagacctcatg tcctactgtgaggaacatgccaggaatgaccctctgctgatggggataccaacttcagaa aaccccttcaaggataagaagacctgcaccatcttatag

DBGET integrated database retrieval system