Bos mutus (wild yak): 102287480 Help Entry 102287480         CDS       T02919                                  Name (RefSeq) stefin-C   KO K13907   cystatin-A/B Organism bom  Bos mutus (wild yak) Brite KEGG Orthology (KO) [BR:bom00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:bom01002]     102287480   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102287480 Peptidases and inhibitors [BR:bom01002]  Peptidase inhibitors   Family I25: cystatin family    102287480 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102287480 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  102287480 NCBI-ProteinID:  XP_005907640 UniProt:  L8HTX6 LinkDB All DBs Position Un AA seq 101 aa AA seqDB search MWAPNLGGFSDTQDATAEIQAIADQVKSQLEEKENKKFPVFKAVKFRSQVVAGMNYLIKV QVDEDDFVHIRVFESLPHENKPVALTSYQTNKSRHDELTYF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtgggcaccaaatcttggtgggttctcagatactcaggatgccacagccgagatccag gccatcgctgaccaggtgaagtcccagctggaggagaaggagaacaagaagttcccagtg ttcaaggctgtgaaattcaggagccaggtggttgccgggatgaactacttgatcaaggtt caagtggacgaggatgacttcgtgcacatccgagtgtttgaaagcctcccacacgagaac aagcccgtggccttgaccagctaccagaccaacaaaagcaggcatgacgagctgacctac ttctag

DBGET integrated database retrieval system