Bos mutus (wild yak): 102287762 Help Entry 102287762         CDS       T02919                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism bom  Bos mutus (wild yak) Brite KEGG Orthology (KO) [BR:bom00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:bom01002]     102287762 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102287762 (CSTB) Peptidases and inhibitors [BR:bom01002]  Peptidase inhibitors   Family I25: cystatin family    102287762 (CSTB) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102287762 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  102287762 NCBI-ProteinID:  XP_005907641 UniProt:  A0A6B0QZR8 LinkDB All DBs Position Un AA seq 98 aa AA seqDB search MMCGGTSATQPATAETQAIADKVKSQLEEKENKKFPVFKALEFKSQLVAGKNYFIKVQVD EDDFVHIRVFESLPHENKPVALTSYQTNKGRHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagggacttccgccacgcagccggccacagccgagacccaggccatcgcc gacaaggtcaagtcccagctggaggagaaggagaacaagaagttcccagtgttcaaggct ctggagttcaaaagccagttggttgctgggaagaactacttcatcaaggttcaagtggac gaggacgacttcgtgcacatccgagtgtttgaaagcctcccgcatgagaacaagcccgtg gccttgaccagctaccagaccaacaaaggcaggcacgacgagctgacctacttctag

DBGET integrated database retrieval system