Bos mutus (wild yak): 106700873 Help Entry 106700873         CDS       T02919                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106700873  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106700873   09163 Immune disease    05322 Systemic lupus erythematosus     106700873   09165 Substance dependence    05034 Alcoholism     106700873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     106700873   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     106700873 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106700873 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106700873 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF5393 Motif Other DBs NCBI-GeneID:  106700873 NCBI-ProteinID:  XP_014334020 UniProt:  L8IKL6 LinkDB All DBs Position 27:complement(4382187..4382567) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKHSCKESYSVYVYKVLKQVHLDTSISSKAM GITNSFVNDIFECIAGEASRLAHYNKRSTITSREIQTAMRLLLPGELAKHTMSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaaatctgctcctgcccctaaaaagggctctaaaaaagctgtgacc aaggcccagaagaaggacggcaagaagcgcaagcacagctgcaaggagagctactccgtg tatgtgtacaaggtgctgaagcaagtccatctggacaccagcatctcctccaaggccatg ggaatcacgaactccttcgtcaacgacattttcgagtgcatcgctggcgaggcatcgcgc ctggcgcattacaacaagcgctcgactatcacatccagggagatccagaccgccatgcgc ttgctgctacctggggagctggccaagcacaccatgtccgagggcactaaggctgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system