Bos mutus (wild yak): 138983904 Help Entry 138983904         CDS       T02919                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     138983904  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     138983904   09163 Immune disease    05322 Systemic lupus erythematosus     138983904   09165 Substance dependence    05034 Alcoholism     138983904  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     138983904 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138983904 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  138983904 NCBI-ProteinID:  XP_070216921 LinkDB All DBs Position 23:20196175..20200055 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggtaaaggtggaaaaggtcttgggaaaggaggcgcgaagcgtcaccgt aaggttctgcgggataacattcaaggtattactaaacccgccatccgccgcttggctcgt cgcggtggggtcaagcgcatctctggcctcatttacgaggaaactcgcggggtgctgaaa gtgttcttagaaaacgtgattcgggacgcggtcacctacaccgagcacgccaagcgaaag acggtgacggccatggacgtcgtctacgcgctgaaacgtcagggacgcactctctacgga tttggcggctaa

DBGET integrated database retrieval system