Bos mutus (wild yak): 138987578 Help Entry 138987578         CDS       T02919                                  Symbol H2BK1 Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     138987578 (H2BK1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     138987578 (H2BK1)   09163 Immune disease    05322 Systemic lupus erythematosus     138987578 (H2BK1)   09165 Substance dependence    05034 Alcoholism     138987578 (H2BK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     138987578 (H2BK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     138987578 (H2BK1) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138987578 (H2BK1) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138987578 (H2BK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF CENP-T_C DUF6246 YscO-like Motif Other DBs NCBI-GeneID:  138987578 NCBI-ProteinID:  XP_070225009 LinkDB All DBs Position 4:complement(670921..676385) Genome browser AA seq 122 aa AA seqDB search MSAEHGQLQQSGGRRGRSPGDKKSRRRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDLFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgagcacggacagctgcagcagtctgggggccggcgcggccggagtcctggg gacaagaagtccagaaggcgcagccggcgcaaagaaacctactccatgtacatctataag gtgctgaagcaggtgcaccccgacatcggcatctcctccaaggccatgagcatcatgaac tcgttcgtgaacgatctgtttgagcggctggctggtgaggccgcccggctggcccagtac tcaggccgaaccacactgacgtcccgggaggtccagacggccgtgcgtctgctgctgcct ggggagctggccaagcacgctgtgtccgagggcaccaaggccgtgaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system