Bos mutus (wild yak): 138988994 Help Entry 138988994         CDS       T02919                                  Name (RefSeq) interferon alpha-1   KO K05414   interferon alpha Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04936   Alcoholic liver disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05200   Pathways in cancer bom05320   Autoimmune thyroid disease bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     138988994    04151 PI3K-Akt signaling pathway     138988994   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138988994  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138988994  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138988994    04621 NOD-like receptor signaling pathway     138988994    04622 RIG-I-like receptor signaling pathway     138988994    04623 Cytosolic DNA-sensing pathway     138988994    04650 Natural killer cell mediated cytotoxicity     138988994  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     138988994   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     138988994    05161 Hepatitis B     138988994    05160 Hepatitis C     138988994    05171 Coronavirus disease - COVID-19     138988994    05164 Influenza A     138988994    05162 Measles     138988994    05168 Herpes simplex virus 1 infection     138988994    05163 Human cytomegalovirus infection     138988994    05167 Kaposi sarcoma-associated herpesvirus infection     138988994    05169 Epstein-Barr virus infection     138988994    05165 Human papillomavirus infection     138988994   09171 Infectious disease: bacterial    05152 Tuberculosis     138988994   09163 Immune disease    05320 Autoimmune thyroid disease     138988994   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138988994   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     138988994  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     138988994 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interferons    138988994 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  138988994 NCBI-ProteinID:  XP_070232239 LinkDB All DBs Position 8:complement(89164701..89165270) Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLKRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVFREVTQHTFQLFSTEGSAAVWDESLLDKLRTALDQQLTDLQ ACLRQEEGLPGAPLLKEDSSLAVRKYFHTITLYLQEKRHSPCAWEVVRAQVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgt tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaagagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcactgggtggcagccagttgcagaaggctcaagccatctctgtgttc cgggaggtgacccagcacaccttccagctcttcagcacagagggctcggccgctgtgtgg gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgccaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacacaatcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system