Bos mutus (wild yak): 138992036 Help Entry 138992036         CDS       T02919                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04620   Toll-like receptor signaling pathway bom05142   Chagas disease bom05163   Human cytomegalovirus infection bom05323   Rheumatoid arthritis bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138992036    04061 Viral protein interaction with cytokine and cytokine receptor     138992036  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138992036    04062 Chemokine signaling pathway     138992036  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     138992036   09174 Infectious disease: parasitic    05142 Chagas disease     138992036   09163 Immune disease    05323 Rheumatoid arthritis     138992036   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138992036  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     138992036    00536 Glycosaminoglycan binding proteins [BR:bom00536]     138992036 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    138992036 Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Chemokines    138992036 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  138992036 NCBI-ProteinID:  XP_070244986 LinkDB All DBs Position 19:complement(47729037..47740081) Genome browser AA seq 89 aa AA seqDB search MKVLVAAVFVLCTVALCSCARERVHTPPTCCFTYTSGKIPRGNVVNYFKTSSNCPKSGII FLTRRGLSVCVDPADSWVQEYIRDLEKSP NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcctcgtggctgctgtctttgtcctctgcactgtggccctctgctcctgtgca cgagaaagggttcacaccccacccacttgctgcttcacctacacctctgggaaaatcccc cgtggaaatgtggttaactattttaagaccagcagcaactgccccaaatctggtatcatc ttcctcaccagaaggggcctatctgtctgtgtcgatcctgctgatagctgggtccaggaa tacatcagggacctggagaagagcccctga

DBGET integrated database retrieval system