Bos mutus (wild yak): 22161777 Help Entry 22161777          CDS       T02919                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism bom  Bos mutus (wild yak) Pathway bom00190   Oxidative phosphorylation bom01100   Metabolic pathways bom04714   Thermogenesis bom04723   Retrograde endocannabinoid signaling bom05010   Alzheimer disease bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05208   Chemical carcinogenesis - reactive oxygen species bom05415   Diabetic cardiomyopathy Module bom_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:bom00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     22161777 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     22161777 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     22161777 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     22161777 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     22161777 (ND6)    05012 Parkinson disease     22161777 (ND6)    05014 Amyotrophic lateral sclerosis     22161777 (ND6)    05016 Huntington disease     22161777 (ND6)    05020 Prion disease     22161777 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     22161777 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     22161777 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bom03029]     22161777 (ND6) Enzymes [BR:bom01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      22161777 (ND6) Mitochondrial biogenesis [BR:bom03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     22161777 (ND6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 Motif Other DBs NCBI-GeneID:  22161777 NCBI-ProteinID:  YP_009107158 UniProt:  A0A097KZN3 LinkDB All DBs Position MT:complement(13914..14441) Genome browser AA seq 175 aa AA seqDB search MMLYIVFILSVIFVIGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIY LGGMMVVFGYTTAMATEQYPEIWLSNKAVLGAFITGLLMEFFMVYYVLKDKEVEIVFEFN GLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLFIGVVVIMEITRGN NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgatactatacattgtatttattttaagtgttatctttgtgattggtttcgtagggttt tcttcgaaaccttcacctatttatggggggttggggttaattgtgagtggtggggttggt tgtggaattgtgttgaattttggtgggtcttttctggggttaatggtttttttaatttat ttggggggtatgatggtggtttttggttatacaacggctatggctacggaacagtaccct gagatttgactttctaataaggctgttttaggggcatttattactggcttgttgatggag ttttttatggtttattatgtgttaaaggataaggaggtggagattgtgtttgagtttaat ggtttaggggattgggtaatttatgatacgggggattctgggttttttagtgaggaggcc atagggattgcagctttatacagttatggtacttgattagttattgtaactgggtggtct ttatttattggtgttgtggttattatagaaattactcgtggaaattaa

DBGET integrated database retrieval system