KEGG   Cytobacillus oceanisediminis: A361_07460
Entry
A361_07460        CDS       T04330                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bon  Cytobacillus oceanisediminis
Brite
KEGG Orthology (KO) [BR:bon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bon03000]
    A361_07460
Transcription factors [BR:bon03000]
 Prokaryotic type
  Other transcription factors
   Others
    A361_07460
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Methyltransf_2 MEDS
Other DBs
NCBI-ProteinID: AND38959
UniProt: A0A160M8J1
LinkDB
Position
1459641..1460600
AA seq 319 aa
MHKTLVKFGILLLCLLLLASCRQSMSTGKLEKAGLLVPDTVNDQVWGTKGYKGMLKIQSH
YNVEVYYKEGMNSEMVVERAVKEFDQKGVNLIFGHGNEYAAYFNNISKKYPDIHFVSFNG
DAKNDNTTSLNFEAYAMGFFGGMVAGHMTKTNNIGILAAFEWQPEVEGFYQGVSEIDEGI
NVQIQYVGNWDNDNKAIALLDKMIANKTDVVYPAGDGYNVPVIEKLKEEGLYAIGYISDQ
SDLGESVVLTSTVQHVDVLYELVAKKFNEGELESGNLTFDFEDEVISLGKFSPDVDEEFK
KELNAAIENYKKTGKLPNE
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcataagacattagtgaaattcgggatccttcttttgtgccttcttttattggcctcc
tgcagacaatcgatgtctacaggaaaacttgaaaaagctggattattagtgcccgatacc
gtcaatgatcaggtatgggggacgaaaggctataaaggcatgttaaagattcaatcccat
tataatgtggaggtttattataaagagggcatgaattctgagatggttgttgaaagagct
gttaaagagtttgatcaaaaaggtgtaaacctgatttttggacatggcaatgaatacgcg
gcatactttaataacatttcaaaaaaataccctgacattcattttgtcagctttaatggc
gatgccaaaaatgacaacaccaccagcttgaattttgaagcctatgcaatgggattcttt
ggcggcatggttgctggccatatgacgaaaaccaataacataggaatactcgcagctttt
gaatggcagccggaggtagaaggtttttatcaaggtgtaagcgaaattgatgaaggtata
aacgtgcaaatccaatatgtcggcaactgggacaatgataataaagccatagctctcttg
gacaaaatgattgccaataagacagatgttgtctatccagctggagatgggtataatgtt
cctgtcatcgagaaactaaaagaggaagggctctacgccatcggctatatttccgaccag
tctgatctgggtgaatcagtcgtcctgaccagtacggttcagcatgtcgatgttttgtat
gaactagtggcaaaaaaattcaacgaaggcgaactggaatcaggaaatctaacctttgat
ttcgaggatgaagttatttcacttgggaaattcagccctgacgtcgacgaagaattcaaa
aaagaactaaacgctgccattgagaattacaaaaaaacaggcaaactgcccaacgagtaa

DBGET integrated database retrieval system