Rhodophyticola sp. CCM32: E2K80_16400 Help Entry E2K80_16400       CDS       T05925                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism boo  Rhodophyticola sp. CCM32 Brite KEGG Orthology (KO) [BR:boo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:boo03032]     E2K80_16400    03036 Chromosome and associated proteins [BR:boo03036]     E2K80_16400    03400 DNA repair and recombination proteins [BR:boo03400]     E2K80_16400 DNA replication proteins [BR:boo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E2K80_16400 Chromosome and associated proteins [BR:boo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E2K80_16400 DNA repair and recombination proteins [BR:boo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E2K80_16400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  QBY02122 UniProt:  A0A4P7JLY4 LinkDB All DBs Position complement(3361453..3361743) Genome browser AA seq 96 aa AA seqDB search MAQKPMTKTQLVTALADEMGSDKKTASAALDAVTAVVTKEVAGGGACTIPGVGKVYCRER PARMVRNPATGEQIHKDADKVVKVTIAKALKDSVNG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcacagaaacccatgacaaagacgcaactggttactgcgctggccgatgagatgggc agtgacaagaaaaccgcaagtgctgcgctggatgcagtgaccgctgtggtgaccaaggaa gtggctggcggcggcgcctgcacgatcccgggtgttggcaaagtctattgccgcgagcgg cccgcacgcatggtgcgcaaccccgccaccggtgagcagatccacaaggatgccgacaag gtggtcaaagtgaccatcgccaaggccctgaaggacagtgtgaacggctga

DBGET integrated database retrieval system