Bosea sp. PAMC 26642: AXW83_01685 Help Entry AXW83_01685       CDS       T04264                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism bop  Bosea sp. PAMC 26642 Brite KEGG Orthology (KO) [BR:bop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bop03032]     AXW83_01685    03036 Chromosome and associated proteins [BR:bop03036]     AXW83_01685    03400 DNA repair and recombination proteins [BR:bop03400]     AXW83_01685 DNA replication proteins [BR:bop03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXW83_01685 Chromosome and associated proteins [BR:bop03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXW83_01685 DNA repair and recombination proteins [BR:bop03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXW83_01685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AMJ63382 UniProt:  A0A126P603 LinkDB All DBs Position complement(365627..365899) Genome browser AA seq 90 aa AA seqDB search MTKNELIAAIAEETSKSKTDVSAILTSLGAIVAKTLKAGDDVTLGGVGKLSAAKRDAREA RNPSTGAMIKVPAKTVVKFKVTKDLAEAVA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaacgaattgattgccgccattgctgaagagaccagcaagtccaagaccgac gtttcggccatcctgacttcgctgggtgcgatcgtcgccaagacgctgaaggccggcgac gacgtcacgctcggcggcgtcggcaagctatcggctgccaagcgcgatgcccgcgaggcc cgcaacccgtccaccggtgccatgatcaaggttccggccaagacggtcgtgaagttcaag gtcaccaaggacctcgccgaagccgtcgcgtaa

DBGET integrated database retrieval system