Bosea sp. PAMC 26642: AXW83_06005
Help
Entry
AXW83_06005 CDS
T04264
Symbol
pleD
Name
(GenBank) diguanylate cyclase response regulator
KO
K02488
two-component system, cell cycle response regulator [EC:
2.7.7.65
]
Organism
bop
Bosea sp. PAMC 26642
Pathway
bop02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
bop00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
AXW83_06005 (pleD)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bop02022
]
AXW83_06005 (pleD)
Enzymes [BR:
bop01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.65 diguanylate cyclase
AXW83_06005 (pleD)
Two-component system [BR:
bop02022
]
Cell cycle family
PleC-PleD (cell fate control)
AXW83_06005 (pleD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GGDEF
Response_reg
GGDEF_2
GGDEF_GdpP
Cortex-I_coil
Motif
Other DBs
NCBI-ProteinID:
AMJ59910
LinkDB
All DBs
Position
1284489..1285865
Genome browser
AA seq
458 aa
AA seq
DB search
MSARVLVVDDIVTNLKLLEAKLSAEYFDVTTALNGLDALAICERGEADIVLLDVMMPGMN
GFEVCRRLKGGATTAHIPVVMVTALDQPSDRLKGLDAGADDFLTKPLDDTALFARVRSLV
RLKSVTDELRNRALASRRLGIADPLAAAAAETGLNGRILLIEDRPSVTERMEQALSAFHV
VETEADPHQALIRAAEGDFDSILVSLDLKSHDGLRLCSQLRSLERTRNVSVLMLGEAEDR
GRILRGLEIGAHDFLIRPVDRNELLARVRTQVRRKRFTDKLRDSVQSSMEMAVMDQLTGL
HNRRFMDSRMAAMFDESALRARSLAMLVLDVDRFKTVNDTWGHDAGDEVLREFADRVRSC
TRGIDLVARMGGEEVVVVLPDTTLEAACTIAERIRERVEAEEFAIHGNTRSVPVTVSIGV
ASRRAGDTSSAEMMKRADDALYRAKASGRNRVIVANAA
NT seq
1377 nt
NT seq
+upstream
nt +downstream
nt
atgtccgcccgcgtcctggtcgtcgacgatatcgtgactaacctgaagctgctcgaggcg
aagctgtcagccgagtatttcgacgtcacgacggcgctgaacggcctggatgcactggcg
atctgcgagcgcggcgaggccgatatcgtgctgctcgacgtgatgatgccgggcatgaac
ggcttcgaggtctgtcggcgcctgaaaggcggtgcgacgaccgcccatatcccggtcgtg
atggtgaccgcgctcgaccagccgagcgatcggctcaaggggctggatgccggcgcagac
gacttcctgaccaagcctctcgacgacacggcgctgtttgcccgtgtccgcagcctggtc
aggctgaaatcggtcaccgacgagttgcgcaaccgggcactggcctcgcgccgcctcggc
atcgccgaccctctcgccgccgccgctgccgagaccggcctgaacgggcgcatcctgctt
atcgaggaccgccccagcgtgacggagcggatggagcaggcgctgtcggccttccacgtc
gtcgagacggaggccgatccacatcaggcgttgatccgcgcggccgagggcgacttcgac
agtatcctcgtaagcctcgacctgaaatcccatgacgggctgcgcctgtgcagccagttg
cggtcgctggagcgcacccgcaacgtctcggtgttgatgctcggcgaggccgaggatcgc
ggacgcatcctgcgcggccttgagatcggcgcacacgactttctcatccgtccggtcgac
cgcaacgaactgcttgcccgcgtgcgcacccaggtccgccgcaaacgcttcaccgacaag
ctgcgcgacagcgtccagtcctccatggagatggcggtgatggaccagctcaccgggctc
cataatcgccgcttcatggacagccgcatggccgcgatgttcgacgaatcggctttgcgc
gcccgttccctggcgatgctcgtgctcgatgtcgatcgtttcaagacggtcaacgacacc
tggggccacgatgccggcgacgaggtgctgcgcgagttcgccgacagggtccgctcctgc
acgcgcggcatcgatctcgtcgctcgcatgggtggggaagaggtggtggtcgtgctgccc
gacacgacgctggaggccgcctgcaccatcgccgaacgtatccgagagcgggtcgaggcc
gaggaattcgcgatccacggcaataccagatccgttccggtaaccgtctcgatcggcgtc
gccagccggcgcgccggcgatacctcctcagccgagatgatgaagcgtgccgacgacgcg
ctctatcgggccaaggcaagcggccgtaaccgggtcatcgtcgcgaatgcggcataa
DBGET
integrated database retrieval system