Bipolaris oryzae: COCMIDRAFT_94569 Help Entry COCMIDRAFT_94569  CDS       T03125                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism bor  Bipolaris oryzae Pathway bor04145   Phagocytosis bor04517   IgSF CAM signaling bor04814   Motor proteins Brite KEGG Orthology (KO) [BR:bor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     COCMIDRAFT_94569  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     COCMIDRAFT_94569   09142 Cell motility    04814 Motor proteins     COCMIDRAFT_94569  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bor03037]     COCMIDRAFT_94569    04812 Cytoskeleton proteins [BR:bor04812]     COCMIDRAFT_94569 Cilium and associated proteins [BR:bor03037]  Motile cilia and associated proteins   Dynein arm    COCMIDRAFT_94569 Cytoskeleton proteins [BR:bor04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      COCMIDRAFT_94569 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light WHD_GDS1 Motif Other DBs NCBI-GeneID:  19128474 NCBI-ProteinID:  XP_007687688 JGI:  Cocmi1_94569 UniProt:  W6Z228 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MASEKSDTQKQDAQIKSADMSEEMQQEAIEVAQSAMEQFTIEKDIAQYIKKEFDSRKGAT WHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaaaagtcagatacccagaagcaggatgcccagattaagtcggcagacatg agcgaagagatgcagcaagaggccattgaagtcgcacagtcggcaatggaacagttcact attgagaaggacattgcccagtacatcaagaaggagttcgacagcaggaagggtgctaca tggcactgcatcgtaggccgtaacttcgggagcttcgttactcacgagacgaagcacttc atctacttctacctcggtcactgcgcaatcttgctcttcaagacacagtag

DBGET integrated database retrieval system