Bosea sp. RAC05: BSY19_117 Help Entry BSY19_117         CDS       T04462                                  Name (GenBank) hypothetical protein   KO K02389   flagellar basal-body rod modification protein FlgD Organism bos  Bosea sp. RAC05 Pathway bos02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bos00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BSY19_117  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bos02035]     BSY19_117 Bacterial motility proteins [BR:bos02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     BSY19_117 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgD VPS53_C Motif Other DBs NCBI-ProteinID:  AOG04907 UniProt:  A0A1B3NHT9 LinkDB All DBs Position 124325..124594 Genome browser AA seq 89 aa AA seqDB search MDVSSIPSTTTSTSSTSTSTKNAMGDYNTFLQLLIAQAKNQDPTNPTDPAQYVQQFAALS QVEQSVTANAKLDQIIAGIAALKPATTQA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggacgtgagcagcatcccgagcacgacgacgagcacgagctcgacgtcgacgagcacc aagaacgccatgggcgactacaacaccttcctccagctcctgatcgcccaggccaagaac caggacccgaccaacccgaccgatccggcgcaatacgtccagcaattcgcggcgctctcg caggtcgagcagtcggtcaccgccaacgccaagctcgaccagatcatcgccggcatcgcg gcgctgaagcccgccacgacgcaagcctga

DBGET integrated database retrieval system