KEGG   Bosea sp. RAC05: BSY19_4246
Entry
BSY19_4246        CDS       T04462                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
bos  Bosea sp. RAC05
Pathway
bos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bos00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY19_4246 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bos02022]
    BSY19_4246 (phoB)
Two-component system [BR:bos02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   BSY19_4246 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C LFE_1968-like
Other DBs
NCBI-ProteinID: AOG05684
LinkDB
Position
complement(4454500..4455198)
AA seq 232 aa
MAARILIVEDEEPLTLLLRYNLEAEGFVVDSVARGDDAELHLRDNTPDLVLLDWMLPGLS
GIELCRRLRARRDTERVPIIMLTARGEETERVRGLATGADDYVVKPFSLPELIARIQALL
RRAKPGHVAGLLTAGDLELDRTTRRVRRSGEELHLGPTEFRLLEFLMQAPGRVYSRAQLL
DAVWGRDVYIDERTVDVHVGRLRKAITPGDAKDPLRTVRGAGYAFDETFARV
NT seq 699 nt   +upstreamnt  +downstreamnt
atggccgcccgcatcctgatcgtcgaggacgaggaacccctcaccctgctgctgcgctac
aatctcgaggccgagggcttcgtggtcgacagcgtggcgcgcggcgacgacgccgagctg
cacctgcgcgacaacacgcccgatctcgtgctgctggactggatgctgccggggctgtcg
ggcatcgaactctgccgccggctgcgggcgcggcgcgacaccgagcgggtgccgatcatc
atgctcaccgcacggggcgaggagaccgagcgggtgcgcgggctcgccaccggcgctgac
gactatgtcgtcaagccgttctcgctgccggagctgattgcgcgcatccaggcgctgctg
cgccgggcgaagcccggccatgtcgccggattgctgacggccggcgatctcgaactcgac
cgcacgacgcggcgcgtgcgccgctccggcgaggagctgcatctgggcccgaccgagttc
cgcctgctcgaattcctgatgcaggcgccgggccgggtctattcgcgcgcgcaactgctc
gacgctgtctggggccgcgacgtctacatcgacgagcgcacggtcgacgtccatgtcggg
cgtctgcgcaaggcgatcacgccgggcgacgccaaggacccgctgcgcacggtccgcggc
gcgggctacgccttcgacgagacatttgcgcgggtttga

DBGET integrated database retrieval system