Bosea sp. 685: RMR04_21655 Help Entry RMR04_21655       CDS       T10282                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bose  Bosea sp. 685 Brite KEGG Orthology (KO) [BR:bose00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bose03032]     RMR04_21655    03036 Chromosome and associated proteins [BR:bose03036]     RMR04_21655    03400 DNA repair and recombination proteins [BR:bose03400]     RMR04_21655 DNA replication proteins [BR:bose03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RMR04_21655 Chromosome and associated proteins [BR:bose03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RMR04_21655 DNA repair and recombination proteins [BR:bose03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RMR04_21655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WNJ93984 UniProt:  A0AA95ZLM5 LinkDB All DBs Position 4389610..4389912 Genome browser AA seq 100 aa AA seqDB search MYNPLLKEEFMTKNELIAAIAEETGKTKTDVSAILASLGAVVAKTLKSGDDVTLGGVGKL SAAKREAREARNPSTGAMIKVPAKTVVKFKVTKDLADAVA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt ctgtacaacccccttctcaaggaggaattcatgaccaagaatgaactgatcgccgccatt gccgaagagaccggcaagaccaagaccgacgtctcggccatcctggcctcactgggcgcg gtcgtcgccaagaccctgaagtccggtgacgacgtcacgctgggcggcgtcggcaagctc tcggccgccaagcgcgaggcccgcgaggcccgcaacccctcgaccggcgcgatgatcaag gttccggccaagacggtcgtcaagttcaaggtgaccaaggatctcgctgacgccgtcgcg taa

DBGET integrated database retrieval system