Bradyrhizobium ottawaense: CIT37_33630 Help Entry CIT37_33630       CDS       T05524                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bot  Bradyrhizobium ottawaense Pathway bot01100   Metabolic pathways bot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIT37_33630    00074 Mycolic acid biosynthesis     CIT37_33630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIT37_33630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AWL96517 UniProt:  A0A2U8PGS1 LinkDB All DBs Position complement(4815278..4815517) Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgaacgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgccgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgacgctgcg gaaacgattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system