Brucella ovis: BOV_0464 Help Entry BOV_0464          CDS       T00534                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bov  Brucella ovis Pathway bov01100   Metabolic pathways bov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BOV_0464 (acpP)    00074 Mycolic acid biosynthesis     BOV_0464 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BOV_0464 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ABQ60146 UniProt:  A5VP30 LinkDB All DBs Position I:480073..480309 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system