Brucella ovis: BOV_A0269 Help Entry BOV_A0269         CDS       T00534                                  Name (GenBank) flavoprotein   KO K03186   flavin prenyltransferase [EC:2.5.1.129] Organism bov  Brucella ovis Pathway bov00130   Ubiquinone and other terpenoid-quinone biosynthesis bov00627   Aminobenzoate degradation bov00740   Riboflavin metabolism bov00900   Terpenoid backbone biosynthesis bov01100   Metabolic pathways bov01110   Biosynthesis of secondary metabolites bov01120   Microbial metabolism in diverse environments bov01220   Degradation of aromatic compounds bov01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:bov00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00740 Riboflavin metabolism     BOV_A0269    00130 Ubiquinone and other terpenoid-quinone biosynthesis     BOV_A0269   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     BOV_A0269   09111 Xenobiotics biodegradation and metabolism    00627 Aminobenzoate degradation     BOV_A0269 Enzymes [BR:bov01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.129  flavin prenyltransferase      BOV_A0269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavoprotein Motif Other DBs NCBI-ProteinID:  ABQ62568 UniProt:  A0A0H3ATU3 LinkDB All DBs Position II:274530..274838 Genome browser AA seq 102 aa AA seqDB search MKRIVIGVSGASGSLIPLKLLERLAVMEEVETHLVISDAAQQTLRYELGANGYSLLYRLA ARTYAVEDVASQVAARAIDLIGVGTPQAQSWNPEEKPRRKAG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaagcggatcgtcatcggtgtttcgggtgcttcgggctccctcattcctctcaagctt cttgagcggctcgcggtgatggaggaggtggaaacccaccttgtcatttccgatgccgcg cagcagaccttgcgctacgagcttggagcgaacggctattccttgctgtaccggctggcc gcgcgcacctatgcggtggaggatgtagcgagccaggtcgccgcgcgcgccattgatctc attggcgtcggcacaccgcaggcgcaaagctggaacccggaagaaaaaccccgccggaag gcggggtga

DBGET integrated database retrieval system