Brasilonema octagenarum: DP113_32125 Help Entry DP113_32125       CDS       T10103                                  Symbol psbE Name (GenBank) cytochrome b559 subunit alpha   KO K02707   photosystem II cytochrome b559 subunit alpha Organism box  Brasilonema octagenarum Pathway box00195   Photosynthesis box01100   Metabolic pathways Module box_M00161   Photosystem II box_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:box00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     DP113_32125 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:box00194]     DP113_32125 (psbE) Photosynthesis proteins [BR:box00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     DP113_32125 (psbE) SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 DUF8676 Motif Other DBs NCBI-ProteinID:  QDL18290 LinkDB All DBs Position 7647597..7647848 Genome browser AA seq 83 aa AA seqDB search MSGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYYPGAR QELPIVNNRFDAKQQVEQFSNTK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaactactggagagcgtccattttcggacattattacgagcgttcgttactgg gtgatccacagcatcaccattcctgcactgtttattgcgggttggttgtttgtcagcact ggcttggcatacgatgcgtttggtacacctcgccctaatgaatattacccaggagcacgg caggaattgccaattgtgaataaccgttttgatgcaaaacaacaagtagaacagtttagt aacacaaagtag

DBGET integrated database retrieval system