Brasilonema octagenarum: DP113_32130 Help Entry DP113_32130       CDS       T10103                                  Name (GenBank) cytochrome b559 subunit beta   KO K02708   photosystem II cytochrome b559 subunit beta Organism box  Brasilonema octagenarum Pathway box00195   Photosynthesis box01100   Metabolic pathways Module box_M00161   Photosystem II box_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:box00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     DP113_32130  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:box00194]     DP113_32130 Photosynthesis proteins [BR:box00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     DP113_32130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  QDL18291 LinkDB All DBs Position 7647858..7647995 Genome browser AA seq 45 aa AA seqDB search MTSGNNVNQPVTYPIFTVRWLAVHTLAVPTIFFLGAIASMQFIQR NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgactagcggaaataacgtcaatcaaccagttacctatccaatttttacagtcagatgg ctagcagttcacactctagctgtgccaactatcttctttttaggcgcgatcgcctcaatg cagtttattcaacgttag

DBGET integrated database retrieval system