KEGG   Orrella marina: DBV39_12675
Entry
DBV39_12675       CDS       T05532                                 
Name
(GenBank) glutamine ABC transporter substrate-binding protein GlnH
  KO
K10036  glutamine transport system substrate-binding protein
Organism
boz  Orrella marina
Pathway
boz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:boz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DBV39_12675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boz02000]
    DBV39_12675
Transporters [BR:boz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    DBV39_12675
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd DctP
Other DBs
NCBI-ProteinID: AWB34418
UniProt: A0A2R4XKT2
LinkDB
Position
complement(2795563..2796324)
AA seq 253 aa
MKSFVKHLAVVAVTATALCGQAAVAQTKSDPLLVAVDTAFVPFEFKEDDKYVGFDIDMWD
AIAKDLNLEYELRPMDFNGILPALQTNNVDVALAGITITDERKKAIDFSDGYYDSGFLIM
VPVDSDIEGAEDLAGKSLALRMGTSAANYAREHFKDTEKRLFPNIDNAYLELQTGRVDAA
MHDTPNVLYYINKAGQGRVKAVGKQMMAHEYGIGFPKGSPHVEQVNEVLEKMRDDGRYEE
IYVKWFGTTPPAR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaaatcattcgtcaaacatctggcagttgttgctgtcactgccacagccctgtgcggt
caggccgccgtggcacagaccaagagcgacccactactcgtcgcggtcgacaccgcattc
gtaccttttgaattcaaggaagatgacaagtacgttggtttcgacattgatatgtgggat
gccatcgccaaagacctgaaccttgagtacgagctgcgcccgatggatttcaacggcatt
ctgcctgcgctgcaaaccaataacgttgatgtcgcacttgccggcatcaccattacagat
gagcgcaagaaagcaatcgacttttctgatggctattacgacagcgggttcctgatcatg
gtgccggtcgacagcgacatcgagggtgcagaggatcttgctggcaagtcactagccttg
cgaatgggcacatcggctgccaattatgcacgagagcatttcaaggataccgagaagcga
ctgtttccgaatattgacaacgcataccttgaactgcagaccgggcgagttgatgccgct
atgcatgacacgccaaacgttctgtattacatcaacaaggcaggccagggacgggtcaag
gctgttggcaagcaaatgatggcccatgagtacggcattgggttccccaagggtagtccg
catgtcgagcaggtcaacgaggtcctggagaagatgcgtgatgatggtcgatacgaagag
atctatgtgaagtggttcggaacgactccgcctgctcgctga

DBGET integrated database retrieval system