Bordetella parapertussis 12822: BPP3758 Help Entry BPP3758           CDS       T00140                                  Symbol ftsL Name (GenBank) putative cell division protein   KO K03586   cell division protein FtsL Organism bpa  Bordetella parapertussis 12822 Brite KEGG Orthology (KO) [BR:bpa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpa03036]     BPP3758 (ftsL) Chromosome and associated proteins [BR:bpa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BPP3758 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  CAE39041 UniProt:  Q7W4A8 LinkDB All DBs Position complement(4065780..4066058) Genome browser AA seq 92 aa AA seqDB search MGRTSLIVAALLMLSAIFLVTSRYQSRQLFIELGRSQAEARDLDTNWRRLQLERAELARN ARIDRAARDDLKMIPIVPDRTLYMNQPAGGAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggggcgcaccagtctcatcgttgccgcgttgctgatgctgtcggccattttcctggtc accagccgctaccagtcgcgccagctcttcatcgaactggggcgcagccaggccgaggcg cgcgatctcgatacgaactggcgccgcctgcagctggagcgggccgagctggcgcgcaac gcccgcatcgaccgtgccgcgcgtgacgacctgaagatgattccgatcgtgcccgaccgc acgctctatatgaaccagcccgccggaggcgcccagtga

DBGET integrated database retrieval system