Bradyrhizobium pachyrhizi: QA639_19630 Help Entry QA639_19630       CDS       T09303                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpah  Bradyrhizobium pachyrhizi Pathway bpah01100   Metabolic pathways bpah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QA639_19630    00074 Mycolic acid biosynthesis     QA639_19630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QA639_19630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WFU59594 LinkDB All DBs Position 4273204..4273443 Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDSASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagattgtggtcgagcaccttggtgtcgaaccc gagaaggtggtcgatagcgcgagcttcatcgatgacctcggcgccgacagcctcgacacc gtcgagctcgtgatggcattcgaagaagaattcggttgcgagattcccgacgacgcggcg gagacgattctgaccgttggcgacgcgaccaagtttcttgagaagaacgcgaagagctga

DBGET integrated database retrieval system