Bacillus paranthracis: NLJ82_09230 Help Entry NLJ82_09230       CDS       T08534                                  Name (GenBank) ACT domain-containing protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bpan  Bacillus paranthracis Pathway bpan00290   Valine, leucine and isoleucine biosynthesis bpan00650   Butanoate metabolism bpan00660   C5-Branched dibasic acid metabolism bpan00770   Pantothenate and CoA biosynthesis bpan01100   Metabolic pathways bpan01110   Biosynthesis of secondary metabolites bpan01210   2-Oxocarboxylic acid metabolism bpan01230   Biosynthesis of amino acids Module bpan_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bpan_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bpan00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     NLJ82_09230    00660 C5-Branched dibasic acid metabolism     NLJ82_09230   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     NLJ82_09230   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     NLJ82_09230 Enzymes [BR:bpan01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      NLJ82_09230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT Motif Other DBs NCBI-ProteinID:  UTO10431 LinkDB All DBs Position 1807901..1808113 Genome browser AA seq 70 aa AA seqDB search MSHTFSLVIDNDPNVLLRISGIFARRGYYISSLNLNESEMELTAVCTEQEATLLVGQLKK LINVLQVNKL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttatcgataacgatccaaatgtcttattacgcataagt ggaatttttgctcggcgtggttattatatttcttcattaaatttaaatgaaagtgaaatg gagttaacggcagtttgtacagaacaagaagcaacattactcgtcggtcagttgaaaaag ttaatcaatgtactgcaagtaaacaaattataa

DBGET integrated database retrieval system