Bacillus paranthracis: NLJ82_17965 Help Entry NLJ82_17965       CDS       T08534                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bpan  Bacillus paranthracis Brite KEGG Orthology (KO) [BR:bpan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bpan03032]     NLJ82_17965    03036 Chromosome and associated proteins [BR:bpan03036]     NLJ82_17965    03400 DNA repair and recombination proteins [BR:bpan03400]     NLJ82_17965 DNA replication proteins [BR:bpan03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NLJ82_17965 Chromosome and associated proteins [BR:bpan03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NLJ82_17965 DNA repair and recombination proteins [BR:bpan03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NLJ82_17965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2530 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  UTO07068 LinkDB All DBs Position 3492341..3492613 Genome browser AA seq 90 aa AA seqDB search MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTG RNPQTGEEMQIAASKVPAFKAGKELKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattaatcaaaaacgtagcacaaaatgctgagatttctcaaaaagaa gctactgtagttgtacaaactgtagtagaatcaatcactaacactttagctgctggtgaa aaagtacaacttatcggattcggtacattcgaagttcgcgaaagagctgctcgtacaggc cgtaacccacaaactggtgaagaaatgcaaatcgcagcttctaaagtacctgctttcaaa gctggtaaagaactaaaagaagctgtaaaataa

DBGET integrated database retrieval system