Bombus pascuorum (common carder bee): 132915094 Help Entry 132915094         CDS       T09597                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bpas  Bombus pascuorum (common carder bee) Pathway bpas04013   MAPK signaling pathway - fly bpas04145   Phagosome bpas04148   Efferocytosis bpas04310   Wnt signaling pathway bpas04517   IgSF CAM signaling bpas04518   Integrin signaling bpas04620   Toll-like receptor signaling pathway bpas05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bpas00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     132915094    04310 Wnt signaling pathway     132915094   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     132915094    04518 Integrin signaling     132915094  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     132915094    04148 Efferocytosis     132915094  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132915094  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     132915094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpas04131]     132915094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bpas04147]     132915094    04031 GTP-binding proteins [BR:bpas04031]     132915094 Membrane trafficking [BR:bpas04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     132915094  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     132915094   Macropinocytosis    Ras GTPases     132915094  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     132915094 Exosome [BR:bpas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132915094   Exosomal proteins of other body fluids (saliva and urine)    132915094   Exosomal proteins of colorectal cancer cells    132915094   Exosomal proteins of bladder cancer cells    132915094 GTP-binding proteins [BR:bpas04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     132915094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  132915094 NCBI-ProteinID:  XP_060830733 LinkDB All DBs Position 16:342664..345645 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctc ataagctacactaccaacgctttccctggagaatatattccgactgtatttgacaattat tccgccaatgttatggtggatggtaaaccaataaatcttggtttatgggacacagcaggc caagaagattatgacagattaagaccattgtcttacccacagacagatgtttttctgatc tgtttttctcttgttaaccccgccagttttgaaaatgttcgtgctaaatggtatccagaa gtacgccatcattgtccagctactccaattattttagtagggactaaactagatttacgt gaagacaaagagactattgagcggttaaaagataaaaaacttgcacctattacatatcct cagggtttgtccatggcaaaagaaattggtgctgtaaaatatttagaatgttctgctctt actcagaaaggtttgaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system