Bombus pascuorum (common carder bee): 132915094 Help Entry 132915094         CDS       T09597                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bpas  Bombus pascuorum (common carder bee) Pathway bpas04013   MAPK signaling pathway - fly bpas04145   Phagosome bpas04148   Efferocytosis bpas04310   Wnt signaling pathway bpas04620   Toll-like receptor signaling pathway bpas05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bpas00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     132915094    04310 Wnt signaling pathway     132915094  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     132915094    04148 Efferocytosis     132915094  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132915094  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     132915094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpas04131]     132915094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bpas04147]     132915094    04031 GTP-binding proteins [BR:bpas04031]     132915094 Membrane trafficking [BR:bpas04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     132915094  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     132915094   Macropinocytosis    Ras GTPases     132915094  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     132915094 Exosome [BR:bpas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132915094   Exosomal proteins of other body fluids (saliva and urine)    132915094   Exosomal proteins of colorectal cancer cells    132915094   Exosomal proteins of bladder cancer cells    132915094 GTP-binding proteins [BR:bpas04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     132915094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  132915094 NCBI-ProteinID:  XP_060830733 LinkDB All DBs Position 16:342664..345645 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctc ataagctacactaccaacgctttccctggagaatatattccgactgtatttgacaattat tccgccaatgttatggtggatggtaaaccaataaatcttggtttatgggacacagcaggc caagaagattatgacagattaagaccattgtcttacccacagacagatgtttttctgatc tgtttttctcttgttaaccccgccagttttgaaaatgttcgtgctaaatggtatccagaa gtacgccatcattgtccagctactccaattattttagtagggactaaactagatttacgt gaagacaaagagactattgagcggttaaaagataaaaaacttgcacctattacatatcct cagggtttgtccatggcaaaagaaattggtgctgtaaaatatttagaatgttctgctctt actcagaaaggtttgaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system