Butyrivibrio proteoclasticus: bpr_I2059
Help
Entry
bpr_I2059 CDS
T01292
Name
(GenBank) response regulator domain-containing protein
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bpb
Butyrivibrio proteoclasticus
Pathway
bpb02020
Two-component system
bpb02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
bpb00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
bpr_I2059
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
bpr_I2059
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bpb02022
]
bpr_I2059
02035 Bacterial motility proteins [BR:
bpb02035
]
bpr_I2059
Two-component system [BR:
bpb02022
]
CheA family
CheA-CheYBV (chemotaxis)
bpr_I2059
Bacterial motility proteins [BR:
bpb02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
bpr_I2059
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID:
ADL34793
UniProt:
E0RYU8
LinkDB
All DBs
Position
1:2511324..2511686
Genome browser
AA seq
120 aa
AA seq
DB search
MGKRVLITDDAAFMRMMLKDILSKNGYEIAGEAENGKVAIEKYNELKPDLVTLDITMPEL
DGIGALKGIKAADPNAVCIMCSAMGQQAMVIESIQAGAKDFIVKPFQADRVLEAVKKAIG
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgggaaaaagagtactcattactgatgacgccgctttcatgcgcatgatgcttaaggat
atcctctccaagaatggatatgagattgctggcgaagctgagaacggtaaagtcgcaatc
gagaagtataatgagttgaagcccgaccttgttactcttgatatcacaatgccagaactt
gatggtatcggagccttgaagggaatcaaggctgcagatcctaatgcagtatgcattatg
tgctctgctatgggtcagcaggcaatggtaattgaatctattcaggctggagctaaagac
tttatcgttaagccattccaggcagatcgtgttcttgaagcggttaaaaaagccattgga
taa
DBGET
integrated database retrieval system