Bordetella pertussis CS: BPTD_0553 Help Entry BPTD_0553         CDS       T01846                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism bpc  Bordetella pertussis CS Pathway bpc00362   Benzoate degradation bpc01100   Metabolic pathways bpc01120   Microbial metabolism in diverse environments bpc01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:bpc00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BPTD_0553    00622 Xylene degradation     BPTD_0553    00621 Dioxin degradation     BPTD_0553 Enzymes [BR:bpc01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BPTD_0553 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AEE66012 LinkDB All DBs Position 576665..576856 Genome browser AA seq 63 aa AA seqDB search MPTVRVELSPGRSAEQKTRYMQEVTRLTVEILKCPVESVDVIFIEIPPTEWAHGGKFYAQ PPA NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgcccaccgtacgcgtcgaactctcccccggccgcagcgccgaacagaaaacccgctat atgcaggaagtcacgcgcctgacggtggagatcctcaagtgcccggtcgaaagcgtggat gtcatcttcatcgaaatcccgccgaccgaatgggcccacggcggaaagttctacgcccag cccccggcttga

DBGET integrated database retrieval system