Burkholderia pseudomallei 668: BURPS668_3876 Help Entry BURPS668_3876     CDS       T00481                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpd  Burkholderia pseudomallei 668 Pathway bpd00998   Biosynthesis of various antibiotics bpd01100   Metabolic pathways bpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BURPS668_3876    00074 Mycolic acid biosynthesis     BURPS668_3876   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BURPS668_3876 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABN82722 LinkDB All DBs Position I:3779547..3779768 Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT VADIDALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system