KEGG   Bordetella pertussis Tohama I: BP0500
Entry
BP0500            CDS       T00139                                 
Name
(GenBank) hypothetical protein
  KO
K15126  type III secretion system cytotoxic effector protein
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP0500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpe02042]
    BP0500
Bacterial toxins [BR:bpe02042]
 Not specified
  BteA
   BP0500
SSDB
Motif
Pfam: DUF3220 DNAJC11_beta-barrel
Other DBs
NCBI-ProteinID: CAE44829
UniProt: Q7VSD3
LinkDB
Position
512199..514169
AA seq 656 aa
MLSNNVNPVVGLSYRPLPETPPSGQAAAHPSMRLLEPNNDEFVRSVASPRLHHSSEALRE
VKHDVRQFQASGDRSLQQLRDLEVALNHWEASQPREFAKRGGLVAELRTAIDAYKQQLHE
QAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFAARLQQSTDALYSHL
EAQWAKQHGTPPTASDVAGMPQWQEYTAMLRERFAGLDTIRPNLTAEENGVAILKTQTQL
LALQRAQEALQASLADGVSHQGDVGLLRTQLLAGMVEGLIALQQADDDSALWSRPSAADS
GGRLSVEAGAKASTDFEAPASKGELLRGKGISGEAVLEAFANIEMSVSGSRAGAAGEAEG
SLRLYGESTARAEVSGSFEPFALSGSIGREEADGDTAASANPVLSLNVSAELSSKLGLEA
QGSVTLGSLLKLDAEGRAEVGASAEVSGAAAIDKRSDGLSVRLEAQAEAFAGLKAEGTLT
ANLLHSKYADAHGLTASVTGSAANVGLGATAEGKLVASPGQFEMGGEVGTTLGVGGNIGW
NSKVDVNASTAYAYELASAAMARFDALRASQLDHDAKTSGNESQLNRLAANLQSHIDATS
QKLDALNSASRIRKVDGFAAGDGAQAAAGLAAQMALVGTGADLSHDIKITALNLRA
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgttgagcaacaacgtcaatccggtcgtcggcctgtcgtaccgccccctgcccgagacg
ccgcccagcggccaggccgccgcacacccctccatgcgcctgctcgagccgaacaacgac
gaattcgtgcgcagcgtggccagcccgcgcctgcaccacagcagcgaggcgctgcgcgaa
gtcaagcacgatgtcaggcagttccaggccagcggcgaccgctcgctgcagcaactgcgc
gacctggaagtggcgctcaatcactgggaggccagccagcccagggagttcgccaagcgc
ggcggcctggtggccgaattgcgcaccgccatcgacgcctacaagcagcagctgcacgag
caggcgcccagccatgccaatctggacgtgaaatggctggatgggctgcgcgccgggtcg
atggcgctgcaaggcgacgtcaaggtctggatgcagaacctcgaagacctgcatacgcgg
cgtcccgacgaattcgccgcccgcctgcagcaatccaccgacgcgctgtacagccacctg
gaggcccaatgggcgaagcagcacggaacgccgcccacggcgagcgacgtcgcgggcatg
ccgcaatggcaggaatacaccgccatgctgcgcgagcgcttcgcgggcctggacaccata
cgccccaacctgacggccgaggaaaacggcgtcgccatcctcaagacgcagacgcagctg
ctggctttgcagcgggcgcaggaagcgctgcaggccagcctggccgacggcgtgtcgcac
cagggcgacgtcggcctgctgcgcacccagttgctggccggcatggtcgaaggattgatc
gccctgcagcaggccgacgacgacagcgcgctatggagccgcccttccgccgccgatagc
ggcggccgcctgtccgtcgaagccggtgccaaggccagcaccgatttcgaggcgccggcc
agcaagggcgagctgctcaggggcaagggcatcagcggcgaagccgtgctggaggcgttc
gccaacatcgagatgagcgtaagcggctcgcgcgccggcgccgccggcgaggcggaaggc
tcgctgcggctgtacggcgagtccacggcacgcgccgaggtgtccgggtcgttcgagcct
ttcgccctgtcgggcagcatcgggcgcgaggaagccgacggcgacaccgcggccagcgcc
aaccccgtgctgtcgctgaacgtgagcgccgagctgtcgagcaagctggggctggaagcc
cagggctcggtgacgctgggcagtttgctcaagctggatgccgaaggacgcgcggaagtc
ggcgccagcgccgaggtctcgggcgcggcggcgatcgacaagcgcagcgacggcctcagc
gtgcgcctggaggcccaggccgaggccttcgcgggcctgaaggccgaaggaacgttgacg
gccaacctgctgcacagcaaatatgccgacgcgcacgggctgaccgcctcggtcaccggt
agcgccgccaatgtcggactgggagccacggccgagggcaagctggtggccagccccggc
cagttcgaaatgggcggcgaggtcggcaccacgctcggcgtgggcggcaatatcggctgg
aacagcaaggtcgacgtcaacgcttcgaccgcctacgcctacgaactggcctcggcggcc
atggcgcgctttgacgccttacgtgccagccagctcgaccatgacgccaagaccagcggc
aacgaaagccagctcaaccgcctggcggccaacctgcaatcgcacatcgacgcgaccagc
caaaaactggatgcactgaacagcgccagccggatccgcaaggtggacgggtttgccgcc
ggcgacggcgcccaggcggcggccggcctggcggcacaaatggccttggtgggaacgggc
gcggacctcagccacgacatcaagatcacggcgctgaatctacgcgcatga

DBGET integrated database retrieval system