Bordetella pertussis Tohama I: BP0607
Help
Entry
BP0607 CDS
T00139
Symbol
gpmA
Name
(GenBank) phosphoglycerate mutase 1
KO
K01834
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:
5.4.2.11
]
Organism
bpe
Bordetella pertussis Tohama I
Pathway
bpe00010
Glycolysis / Gluconeogenesis
bpe00260
Glycine, serine and threonine metabolism
bpe00680
Methane metabolism
bpe01100
Metabolic pathways
bpe01110
Biosynthesis of secondary metabolites
bpe01120
Microbial metabolism in diverse environments
bpe01200
Carbon metabolism
bpe01230
Biosynthesis of amino acids
Module
bpe_M00002
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:
bpe00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00010 Glycolysis / Gluconeogenesis
BP0607 (gpmA)
09102 Energy metabolism
00680 Methane metabolism
BP0607 (gpmA)
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
BP0607 (gpmA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
bpe04131
]
BP0607 (gpmA)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
bpe04147
]
BP0607 (gpmA)
Enzymes [BR:
bpe01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.2 Phosphotransferases (phosphomutases)
5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
BP0607 (gpmA)
Membrane trafficking [BR:
bpe04131
]
Autophagy
Chaperone mediated autophagy (CMA)
Selective cargos
BP0607 (gpmA)
Exosome [BR:
bpe04147
]
Exosomal proteins
Exosomal proteins of bladder cancer cells
BP0607 (gpmA)
Exosomal proteins of melanoma cells
BP0607 (gpmA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
His_Phos_1
CTD3
FimA4_C
Motif
Other DBs
NCBI-ProteinID:
CAE44933
UniProt:
Q7VS43
LinkDB
All DBs
Position
611521..612273
Genome browser
AA seq
250 aa
AA seq
DB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq
753 nt
NT seq
+upstream
nt +downstream
nt
atgtacaaacttgttctgatgcgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggttacgccttcgacctggcctatacctcggtgctcaagcgc
gccatccgcacgctctggatcgccctggacgccatggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgacggccgctacgccaag
atcccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga
DBGET
integrated database retrieval system