KEGG   Bordetella pertussis Tohama I: BP0760
Entry
BP0760            CDS       T00139                                 
Symbol
cyaA
Name
(GenBank) bifunctional hemolysin-adenylate cyclase precursor
  KO
K22944  bifunctional hemolysin/adenylate cyclase [EC:4.6.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00230  Purine metabolism
bpe05133  Pertussis
Module
bpe_M00575  Pertussis pathogenicity signature, T1SS
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BP0760 (cyaA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP0760 (cyaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpe02042]
    BP0760 (cyaA)
Enzymes [BR:bpe01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     BP0760 (cyaA)
Bacterial toxins [BR:bpe02042]
 Type III toxins: Intracellular toxins
  Adenylate cyclase
   Adenylate cyclase toxin (ACT)
    BP0760 (cyaA)
SSDB
Motif
Pfam: RTX Anthrax_toxA HemolysinCabind HCBP_related
Other DBs
NCBI-ProteinID: CAE41066
UniProt: P0DKX7
LinkDB
Position
776228..781348
AA seq 1706 aa
MQQSHQAGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSLIAEGVATKGL
GVHAKSSDWGLQAGYIPVNPNLSKLFGRAPEVIARADNDVNSSLAHGHTAVDLTLSKERL
DYLRQAGLVTGMADGVVASNHAGYEQFEFRVKETSDGRYAVQYRRKGGDDFEAVKVIGNA
AGIPLTADIDMFAIMPHLSNFRDSARSSVTSGDSVTDYLARTRRAASEATGGLDRERIDL
LWKIARAGARSAVGTEARRQFRYDGDMNIGVITDFELEVRNALNRRAHAVGAQDVVQHGT
EQNNPFPEADEKIFVVSATGESQMLTRGQLKEYIGQQRGEGYVFYENRAYGVAGKSLFDD
GLGAAPGVPSGRSKFSPDVLETVPASPGLRRPSLGAVERQDSGYDSLDGVGSRSFSLGEV
SDMAAVEAAELEMTRQVLHAGARQDDAEPGVSGASAHWGQRALQGAQAVAAAQRLVHAIA
LMTQFGRAGSTNTPQEAASLSAAVFGLGEASSAVAETVSGFFRGSSRWAGGFGVAGGAMA
LGGGIAAAVGAGMSLTDDAPAGQKAAAGAEIALQLTGGTVELASSIALALAAARGVTSGL
QVAGASAGAAAGALAAALSPMEIYGLVQQSHYADQLDKLAQESSAYGYEGDALLAQLYRD
KTAAEGAVAGVSAVLSTVGAAVSIAAAASVVGAPVAVVTSLLTGALNGILRGVQQPIIEK
LANDYARKIDELGGPQAYFEKNLQARHEQLANSDGLRKMLADLQAGWNASSVIGVQTTEI
SKSALELAAITGNADNLKSVDVFVDRFVQGERVAGQPVVLDVAAGGIDIASRKGERPALT
FITPLAAPGEEQRRRTKTGKSEFTTFVEIVGKQDRWRIRDGAADTTIDLAKVVSQLVDAN
GVLKHSIKLDVIGGDGDDVVLANASRIHYDGGAGTNTVSYAALGRQDSITVSADGERFNV
RKQLNNANVYREGVATQTTAYGKRTENVQYRHVELARVGQLVEVDTLEHVQHIIGGAGND
SITGNAHDNFLAGGSGDDRLDGGAGNDTLVGGEGQNTVIGGAGDDVFLQDLGVWSNQLDG
GAGVDTVKYNVHQPSEERLERMGDTGIHADLQKGTVEKWPALNLFSVDHVKNIENLHGSR
LNDRIAGDDQDNELWGHDGNDTIRGRGGDDILRGGLGLDTLYGEDGNDIFLQDDETVSDD
IDGGAGLDTVDYSAMIHPGRIVAPHEYGFGIEADLSREWVRKASALGVDYYDNVRNVENV
IGTSMKDVLIGDAQANTLMGQGGDDTVRGGDGDDLLFGGDGNDMLYGDAGNDTLYGGLGD
DTLEGGAGNDWFGQTQAREHDVLRGGDGVDTVDYSQTGAHAGIAAGRIGLGILADLGAGR
VDKLGEAGSSAYDTVSGIENVVGTELADRITGDAQANVLRGAGGADVLAGGEGDDVLLGG
DGDDQLSGDAGRDRLYGEAGDDWFFQDAANAGNLLDGGDGRDTVDFSGPGRGLDAGAKGV
FLSLGKGFASLMDEPETSNVLRNIENAVGSARDDVLIGDAGANVLNGLAGNDVLSGGAGD
DVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQL
WFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPD
PGAAAAAPPAARVPDTLMQSLAVNWR
NT seq 5121 nt   +upstreamnt  +downstreamnt
atgcagcaatcgcatcaggctggttacgcaaacgccgccgaccgggagtctggcatcccc
gcagccgtactcgatggcatcaaggccgtggcgaaggaaaaaaacgccacattgatgttc
cgcctggtcaacccccattccaccagcctgattgccgaaggggtggccaccaaaggattg
ggcgtgcacgccaagtcgtccgattgggggttgcaggcgggctacattcccgtcaacccg
aatctttccaaactgttcggccgtgcgcccgaggtgatcgcgcgggccgacaacgacgtc
aacagcagcctggcgcatggccataccgcggtcgacctgacgctgtcgaaagagcggctt
gactatctgcggcaagcgggcctggtcaccggcatggccgatggcgtggtcgcgagcaac
cacgcaggctacgagcagttcgagtttcgcgtgaaggaaacctcggacgggcgctatgcc
gtgcagtatcgccgcaagggcggcgacgatttcgaggcggtcaaggtgatcggcaatgcc
gccggtattccactgacggcggatatcgacatgttcgccattatgccgcatctgtccaac
ttccgcgactcggcgcgcagttcggtgaccagcggcgattcggtgaccgattacctggcg
cgcacgcggcgggccgccagcgaggccacgggcggcctggatcgcgaacgcatcgacttg
ttgtggaaaatcgctcgcgccggcgcccgttccgcagtgggcaccgaggcgcgtcgccag
ttccgctacgacggcgacatgaatatcggcgtgatcaccgatttcgagctggaagtgcgc
aatgcgctgaacaggcgggcgcacgccgtcggcgcgcaggacgtggtccagcatggcact
gagcagaacaatcctttcccggaggcagatgagaagattttcgtcgtatcggccaccggt
gaaagccagatgctcacgcgcgggcaactgaaggaatacattggccagcagcgcggcgag
ggctatgtcttctacgagaaccgtgcatacggcgtggcggggaaaagcctgttcgacgat
gggctgggagccgcgcccggcgtgccgagcggacgttcgaagttctcgccggatgtactg
gaaacggtgccggcgtcacccggattgcggcggccgtcgctgggcgcagtggaacgccag
gattccggctatgacagccttgatggggtgggatcgcgatcgttctcgttgggcgaggtg
tccgacatggccgccgtggaagcggcggaactggaaatgacccggcaagtcttgcacgcc
ggggcgcggcaggacgatgccgagccgggcgtgagcggtgcgtcggcgcactgggggcag
cgggcgctgcagggcgcccaggcggtggcggcggcgcagcggctggttcatgccattgcc
ctgatgacgcaattcggccgggccggttccaccaacacgccgcaggaagcggcctcgttg
tcggcggccgtgttcggcttgggcgaggccagcagcgccgtggccgaaaccgtgagcggt
tttttccgcgggtcttcgcgctgggccggcggtttcggcgtggctggcggcgcgatggcg
ctgggaggcggcatcgccgcggccgttggcgccgggatgtcgttgaccgatgacgcgccg
gccggacagaaggccgccgccggcgccgagatcgcgctgcagttgacaggtggaacggtc
gagctggcttcttccatcgcgttggcgctggccgcggcgcgcggcgtgaccagcggcttg
caggtggccggggcgtcggccggggcggctgccggcgcattggccgcggcgctcagtccc
atggagatctacggcctggtgcagcaatcgcactatgcggatcagctggacaagctggcg
caggaatcgagcgcatacggttacgagggcgacgccttgctggcccagctgtatcgcgac
aagacggccgccgagggcgccgtcgccggcgtctccgccgtcctgagcacggtgggggcg
gcggtgtcgatcgccgcggcggccagcgtggtaggggccccggtggcggtggtcacttcc
ttgctgaccggggctctcaacggcatcctgcgcggcgtgcagcagcccatcatcgaaaag
ctggccaacgattacgctcgcaagatcgacgagctgggcgggccgcaagcgtacttcgag
aaaaacctgcaggcgcgtcacgaacaactggccaattcggacggcctacggaaaatgctg
gccgacctgcaggccggttggaacgccagcagcgtgatcggggtgcagacgacagagatc
tccaagtcggcgctcgaactggccgccattaccggcaacgcggacaacctgaaatccgtc
gacgtgttcgtggaccgcttcgtccagggcgagcgggtggccggccagccggtggtcctc
gacgtcgccgccggcggcatcgatatcgccagccgcaagggcgagcggccggcgctgacg
ttcatcacgccgctggccgcgccaggagaagagcagcgccggcgcacgaaaacgggcaag
agcgaattcaccacattcgtcgagatcgtgggcaagcaggaccgctggcgcatccgggac
ggcgcggccgacaccaccatcgatctggccaaggtggtgtcgcaactggtcgacgccaat
ggcgtgctcaagcacagcatcaaactggatgtgatcggcggagatggcgatgacgtcgtg
cttgccaatgcttcgcgcatccattatgacggcggcgcgggcaccaacacggtcagctat
gccgccctgggtcgacaggattccattaccgtgtccgccgacggggaacgtttcaacgtg
cgcaagcagttgaacaacgccaacgtgtatcgcgaaggcgtggctacccagacaaccgcc
tacggcaagcgcacggagaatgtccaataccgccatgtcgagctggcccgtgtcgggcaa
ctggtggaggtcgacacgctcgagcatgtgcagcacatcatcggcggggccggcaacgat
tcgatcaccggcaatgcgcacgacaacttcctagccggcgggtcgggcgacgacaggctg
gatggcggcgccggcaacgacaccctggttggcggcgagggccaaaacacggtcatcggc
ggcgccggcgacgacgtattcctgcaggacctgggggtatggagcaaccagctcgatggc
ggcgcgggcgtcgataccgtgaagtacaacgtgcaccagccttccgaggagcgcctcgaa
cgcatgggcgacacgggcatccatgccgatcttcaaaagggcacggtcgagaagtggccg
gccctgaacctgttcagcgtcgaccatgtcaagaatatcgagaatctgcacggctcccgc
ctgaacgaccgcatcgccggcgacgaccaggacaacgagctctggggccacgatggcaac
gacacgatacgcggccggggcggcgacgacatcctgcgcggcggcctgggcctggacacg
ctgtatggcgaggacggcaacgacatcttcctgcaggacgacgagaccgtcagcgatgac
atcgacggcggcgcggggctggacaccgtcgactactccgccatgatccatccaggcagg
atcgttgcgccgcatgaatacggcttcgggatcgaggcggacctgtccagggaatgggtg
cgcaaggcgtccgcgctgggcgtggactattacgataatgtccgcaatgtcgaaaacgtc
atcggtacgagcatgaaggatgtgctcatcggcgacgcgcaagccaataccctgatgggc
cagggcggcgacgataccgtgcgcggcggcgacggcgatgatctgctgttcggcggcgac
ggcaacgacatgctgtatggcgacgccggcaacgacaccctctacggggggctgggcgac
gatacccttgaaggcggcgcgggcaacgattggttcggccagacgcaggcgcgcgagcat
gacgtgctgcgcggcggagatggggtggataccgtcgattacagccagaccggcgcgcat
gccggcattgccgcgggtcgcatcgggctgggcatcctggctgacctgggcgccggccgc
gtcgacaagctgggcgaggccggcagcagcgcctacgatacggtttccggtatcgagaac
gtggtgggcacggaactggccgaccgcatcacgggcgatgcgcaggccaacgtgctgcgc
ggcgcgggtggcgccgacgtgcttgcgggcggcgagggcgacgatgtgctgctgggcggc
gacggcgacgaccagctgtcgggcgacgccggacgcgatcgcttgtacggcgaagccggt
gacgactggttcttccaggatgccgccaatgccggcaatctgctcgacggcggcgacggc
cgcgataccgtggatttcagcggcccgggccggggcctcgacgccggcgcaaagggcgta
ttcctgagcttgggcaaggggttcgccagcctgatggacgaacccgaaaccagcaacgtg
ttgcgcaatatcgagaacgccgtgggcagcgcgcgtgatgacgtgctgatcggcgacgca
ggcgccaacgtcctcaatggcctggcgggcaacgacgtgctgtccggcggcgctggcgac
gatgtgctgctgggcgacgagggctcggacctgctcagcggcgatgcgggcaacgacgat
ctgttcggcgggcagggcgatgatacttatctgttcggggtcgggtacgggcacgacacg
atctacgaatcgggcggcggccatgacaccatccgcatcaacgcgggggcggaccagctg
tggttcgcgcgccagggcaacgacctggagatccgcattctcggcaccgacgatgcactt
accgtgcacgactggtatcgcgacgccgatcaccgggtggaaatcatccatgccgccaac
caggcggtagaccaggcaggcatcgaaaagctggtcgaggcaatggcgcagtatccggac
cccggcgcggcggcggctgccccgccggcggcgcgcgtgccggacacgctgatgcagtcc
ctggctgtcaactggcgctga

DBGET integrated database retrieval system