KEGG   Bordetella pertussis Tohama I: BP3787
Entry
BP3787            CDS       T00139                                 
Symbol
ptxC
Name
(GenBank) pertussis toxin subunit 3 precursor
  KO
K11025  pertussis toxin subunit 3
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Module
bpe_M00574  Pertussis pathogenicity signature, pertussis toxin
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP3787 (ptxC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP3787 (ptxC)
   02042 Bacterial toxins [BR:bpe02042]
    BP3787 (ptxC)
Transporters [BR:bpe02000]
 Other transporters
  Pores ion channels [TC:1]
   BP3787 (ptxC)
Bacterial toxins [BR:bpe02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Pertussis toxin (PT)
    BP3787 (ptxC)
SSDB
Motif
Pfam: Pertussis_S2S3 APT Flavi_NS4B
Other DBs
NCBI-ProteinID: CAE44042
UniProt: P04979
LinkDB
Position
3990696..3991379
AA seq 227 aa
MLINNKKLLHHILPILVLALLGMRTAQAVAPGIVIPPKALFTQQGGAYGRCPNGTRALTV
AELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIY
KTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRL
LYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgctgatcaacaacaagaagctgcttcatcacattctgcccatcctggtgctcgccctg
ctgggcatgcgcacggcccaggccgttgcgccaggcatcgtcatcccgccgaaggcactg
ttcacccaacagggcggcgcctatggacgctgcccgaacggaacccgcgccttgaccgtg
gccgaactgcgcggcaacgccgaattgcagacgtatttgcgccagataacgcccggctgg
tccatatacggtctctatgacggtacgtacctgggccaggcgtacggcggcatcatcaag
gacgcgccgccaggcgcggggttcatttatcgcgaaactttctgcatcacgaccatatac
aagaccgggcaaccggctgcggatcactactacagcaaggtcacggccacgcgcctgctc
gccagcaccaacagcaggctgtgcgcggtattcgtcagggacgggcaatcggtcatcgga
gcctgcgccagcccgtatgaaggcaggtacagagacatgtacgacgcgctgcggcgcctg
ctgtacatgatctatatgtccggccttgccgtacgcgtccacgtcagcaaggaagagcag
tattacgactacgaggacgccacattccagacctatgccctcaccggcatttccctctgc
aacccggcagcgtcgatatgctga

DBGET integrated database retrieval system