Bordetella pertussis B1917: B1917_3788 Help Entry B1917_3788        CDS       T03638                                  Symbol tatA Name (GenBank) twin arginine translocase A   KO K03116   sec-independent protein translocase protein TatA Organism bpet  Bordetella pertussis B1917 Pathway bpet03060   Protein export bpet03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:bpet00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B1917_3788 (tatA)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B1917_3788 (tatA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bpet02044]     B1917_3788 (tatA) Secretion system [BR:bpet02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B1917_3788 (tatA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  AIW93980 LinkDB All DBs Position 4000686..4000913 Genome browser AA seq 75 aa AA seqDB search MGSFSIWHWLIVLVIIALVFGTKKLRNVGSDLGSAVKGFKEGMKDASADKPADQVTQQRV SDDTIDVQAKEKSNS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggtagcttcagtatctggcattggttgattgtcctggtcatcatcgcgctggtgttc ggcaccaagaaactgcgcaacgtcggctcggacctgggaagcgccgtcaagggcttcaag gaaggcatgaaggacgccagcgccgacaagccggccgatcaggtcacgcagcaacgcgtg tccgacgacaccatcgacgtgcaggccaaagagaaaagcaactcctag

DBGET integrated database retrieval system