KEGG   Bordetella pertussis 137: Q425_2750
Entry
Q425_2750         CDS       T03754                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q425_2750 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpeu02022]
    Q425_2750 (phoB)
Two-component system [BR:bpeu02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   Q425_2750 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg DUF7669
Other DBs
NCBI-ProteinID: AJB25135
LinkDB
Position
complement(266919..267617)
AA seq 232 aa
MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGAS
GLSLARKLRDEERTRAVPVIMLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVL
RRRAPQLTDDIIDVAGLKLDPVTHRLSGHSQSLSIGPTEFRLLHFFMTHPERVFSRSQLL
DQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSGYRFTAQVPAR
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtccagcaccattcttgtcgttgaagacgaacccgccatccaggaactgatcgccgtg
aacctttcgttcgcgggccacaaggtcctgcgcgcgttcgatgccgaacaggcccagacc
ctgatccgcgccgagctgcccgacctcatcctgctcgactggatgctgccgggggcctcc
ggcctgtcgctggcccgcaagctgcgcgacgaagagcgcacccgcgccgtcccggtcatc
atgctgacggccaagggcgccgaacaggacaaggtcgacggcctggaggcgggcgccgac
gactacatcaccaagcccttctcgcccaaggagctgatggcgcgcatcaaggccgtgctg
cgccgccgcgccccgcagctgaccgacgacatcatcgacgtcgccgggctgaagctggac
ccggtcacccaccgcctgtcgggccacagccagtcgctgtccatcgggcccaccgagttc
cgcctgctgcacttcttcatgacccacccggagcgggtgttttcccgctcgcagctgctc
gaccaggtgtggggcgaccacgtcttcgtggaagagcgcacggtggacgtacatatccgc
cgcctgcgcaaggcgctggaacccagcggccatgacgcgcacgtcgagacggtgcgcggc
agcggctaccggtttacagcacaggtgccggcgcgctaa

DBGET integrated database retrieval system