Alkalihalophilus pseudofirmus: BpOF4_08075 Help Entry BpOF4_08075       CDS       T01165                                  Name (GenBank) hypothetical protein   KO K06317   inhibitor of the pro-sigma K processing machinery Organism bpf  Alkalihalophilus pseudofirmus Brite KEGG Orthology (KO) [BR:bpf00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     BpOF4_08075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA Motif Other DBs NCBI-ProteinID:  ADC49673 UniProt:  D3FQX7 LinkDB All DBs Position 34345..34608 Genome browser AA seq 87 aa AA seqDB search MDPILVIAILAGLVILLLTVGAPLKPIRFVGQLAVKLVIGALMLFFVNAFGSFFAFHIPI NGVTALVSGVLGIPGLLLLIVTKQFIL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggatccgatcttagttattgcaattttggcagggctggttatcttgttattaacggtt ggggcaccacttaagcccattcgtttcgtcgggcagctagccgttaaacttgtaatcgga gctttgatgttgttctttgtaaatgcttttggttcgttctttgcctttcacattccgatc aatggagtgactgcattagtctccggtgtcctcggaatacctggtctccttctattaatt gtaacgaaacagtttattctttaa

DBGET integrated database retrieval system